NTSR2

DescriptionNeurotensin receptor type 2

Gene and Protein Information

Gene ID23620
Uniprot Accession IDs O95665 Q53QQ5 Q57Z87 Q8IY58 Q8TBH6 NT-R-2
Ensembl ID ENSP00000303686
Symbole NTR2
FamilyBelongs to the G-protein coupled receptor 1 family. Neurotensin receptor subfamily. NTSR2 sub-subfamily.
Sequence
METSSPRPPRPSSNPGLSLDARLGVDTRLWAKVLFTALYALIWALGAAGNALSAHVVLKARAGRAGRLRHHVLSLALAGLLLLLVGVPVELYSFVWFHYPWVFGDLGCRGYYFVHELCAYATVLSVAGLSAERCLAVCQPLRARSLLTPRRTRWLVALSWAASLGLALPMAVIMGQKHELETADGEPEPASRVCTVLVSRTALQVFIQVNVLVSFVLPLALTAFLNGVTVSHLLALCSQVPSTSTPGSSTPSRLELLSEEGLLSFIVWKKTFIQGGQVSLVRHKDVRRIRSLQRSVQVLRAIVVMYVICWLPYHARRLMYCYVPDDAWTDPLYNFYHYFYMVTNTLFYVSSAVTPLLYNAVSSSFRKLFLEAVSSLCGEHHPMKRLPPKPQSPTLMDTASGFGDPPETRT
Afficher plus
Homologous gene and protein info.
SpeciesGene IDGene SymbolNomNuméro d'identification fiscale Other Gene IDSources
Chimp745294NTSR2neurotensin receptor 29598VGNC:328OMA, EggNOG
Macaque697563NTSR2neurotensin receptor 29544Inparanoid, OMA, EggNOG
Mouse18217Ntsr2neurotensin receptor 210090MGI:108018Inparanoid, OMA
Rat64636Ntsr2neurotensin receptor 210116RGD:70962Inparanoid, OMA
Dog482972NTSR2neurotensin receptor 29615VGNC:44015Inparanoid, OMA
Cow539336NTSR2neurotensin receptor 29913VGNC:32313Inparanoid, OMA

Protein Classes

PANTHER Classes
protein    /    receptor    /    G-protein coupled receptor    /    Neurotensin receptor type 2
DTO Classes
protein    /    G-protein coupled receptor    /    Class A rhodopsin like    /    Neurotensin receptor    /    Neurotensin receptor type 2

Associated Recombinant Proteins

NomSpecification and purityExpression systemProtein labelDisponibilitéVoir les détails

Associated Antibodies

NomSpecificationsSpecies reactivityApplicationDisponibilitéVoir les détails

Associated Approved Drugs

    Associated Active Ligands

      Associated Diseases

      NomDirect Associated TargetsDisease TypeMondoid

      Bibliography

      Shall we send you a message when we have discounts available?

      Remind me later

      Thank you! Please check your email inbox to confirm.

      Oops! Notifications are disabled.