🌎 Ship to: United States
Basculer la navigation
Cart
Rechercher
Expédition le jour même pour tous les articles en stock.
Recherche Avancée
Commande rapide SDS / CoA Structure En vrac et personnalisé
Menu
Compte
Paramètres
྾
224,000+ produits de recherche · Triple ISO certified · COA & SDS disponible pour chaque produit · Expédition le jour même sur les articles en stock

PPP1CA

DescriptionSerine/threonine-protein phosphatase PP1-alpha catalytic subunit

Gene and Protein Information

Gene ID5499
Uniprot Accession IDs P62136 A6NNR3 B2R908 P08129 P20653 P22802 Q07161 PP-1A
Ensembl ID ENSP00000326031
Symbole PPP1A PP1A PP-1A PPP1A PP1alpha
FamilyBelongs to the PPP phosphatase family. PP-1 subfamily.
Sequence
MSDSEKLNLDSIIGRLLEVQGSRPGKNVQLTENEIRGLCLKSREIFLSQPILLELEAPLKICGDIHGQYYDLLRLFEYGGFPPESNYLFLGDYVDRGKQSLETICLLLAYKIKYPENFFLLRGNHECASINRIYGFYDECKRRYNIKLWKTFTDCFNCLPIAAIVDEKIFCCHGGLSPDLQSMEQIRRIMRPTDVPDQGLLCDLLWSDPDKDVQGWGENDRGVSFTFGAEVVAKFLHKHDLDLICRAHQVVEDGYEFFAKRQLVTLFSAPNYCGEFDNAGAMMSVDETLMCSFQILKPADKNKGKYGQFSGLNPGGRPITPPRNSAKAKK
Afficher plus
Homologous gene and protein info.
SpeciesGene IDGene SymbolNomNuméro d'identification fiscale Other Gene IDSources
Chimp745709PPP1CAprotein phosphatase 1 catalytic subunit alpha9598VGNC:13321OMA, EggNOG
Macaque721735PPP1CAprotein phosphatase 1 catalytic subunit alpha9544Inparanoid, OMA
Mouse19045Ppp1caprotein phosphatase 1, catalytic subunit, alpha isoform10090MGI:103016Inparanoid, OMA
Rat24668Ppp1caprotein phosphatase 1 catalytic subunit alpha10116RGD:3375Inparanoid, OMA, EggNOG
Horse100059233PPP1CAprotein phosphatase 1 catalytic subunit alpha9796VGNC:49522Inparanoid, OMA, EggNOG
Cow516175PPP1CAprotein phosphatase 1 catalytic subunit alpha9913Inparanoid, OMA
Pig733611PPP1CAprotein phosphatase 1 catalytic subunit alpha9823OMA, EggNOG
Anole lizard100558590ppp1caprotein phosphatase 1 catalytic subunit alpha28377Inparanoid, OMA
C. elegans3564807gsp-2Serine/threonine-protein phosphatase PP1-beta6239Inparanoid, OMA
Fruitfly49260Pp1-87BProtein phosphatase 1 at 87B7227FBgn0004103Inparanoid, OMA

Associated Recombinant Proteins

NomSpecification and purityExpression systemProtein labelDisponibilitéVoir les détails

Associated Antibodies

NomSpecificationsSpecies reactivityApplicationDisponibilitéVoir les détails

Associated Approved Drugs

    Associated Active Ligands

      Associated Diseases

      NomDirect Associated TargetsDisease TypeMondoid

      Bibliography

      🔙[Back to Target (Human)]
      We use cookies to ensure the website functions properly and, where permitted, to improve your experience. You can manage your preferences at any time in Settings. Learn more in our Cookie Policy.

      Shall we send you a message when we have discounts available?

      Remind me later

      Thank you! Please check your email inbox to confirm.

      Oops! Notifications are disabled.

      Privacy Policy Terms of Use Cookie Policy Terms and Conditions of Sale Sales Policy
      Products are supplied to verified businesses, institutions, and qualified professionals for research and development use only. Not for use in humans, animals, diagnosis, or therapy.
      Copyright © 2023–present Aladdin Scientific Corp. All rights reserved.