MAPK11

DescriptionMitogen-activated protein kinase 11

Gene and Protein Information

Gene ID5600
Uniprot Accession IDs Q15759 A8K730 B0LPG1 B7Z630 E7ETQ1 L7RT27 O00284 O15472 Q2XNF2 MAP kinase 11
Ensembl ID ENSP00000333685
Symbole PRKM11 SAPK2 SAPK2B P38B SAPK2 p38-2 PRKM11 SAPK2B p38Beta P38BETA2
FamilyBelongs to the protein kinase superfamily. CMGC Ser/Thr protein kinase family. MAP kinase subfamily.
Sequence
MSGPRAGFYRQELNKTVWEVPQRLQGLRPVGSGAYGSVCSAYDARLRQKVAVKKLSRPFQSLIHARRTYRELRLLKHLKHENVIGLLDVFTPATSIEDFSEVYLVTTLMGADLNNIVKCQALSDEHVQFLVYQLLRGLKYIHSAGIIHRDLKPSNVAVNEDCELRILDFGLARQADEEMTGYVATRWYRAPEIMLNWMHYNQTVDIWSVGCIMAELLQGKALFPGSDYIDQLKRIMEVVGTPSPEVLAKISSEHARTYIQSLPPMPQKDLSSIFRGANPLAIDLLGRMLVLDSDQRVSAAEALAHAYFSQYHDPEDEPEAEPYDESVEAKERTLEEWKELTYQEVLSFKPPEPPKPPGSLEIEQ
Afficher plus
Homologous gene and protein info.
SpeciesGene IDGene SymbolNomNuméro d'identification fiscale Other Gene IDSources
Macaque715794MAPK11mitogen-activated protein kinase 119544Inparanoid, OMA
Mouse19094Mapk11mitogen-activated protein kinase 1110090MGI:1338024Inparanoid, OMA
Rat689314Mapk11mitogen-activated protein kinase 1110116RGD:1309340Inparanoid, OMA
Horse100056278MAPK11mitogen-activated protein kinase 119796VGNC:19956Inparanoid, OMA
Cow618906MAPK11mitogen-activated protein kinase 119913VGNC:31214Inparanoid, OMA
Anole lizard100563731mapk11mitogen-activated protein kinase 1128377Inparanoid, OMA
Zebrafish415185mapk11mitogen-activated protein kinase 117955ZDB-GENE-040625-75Inparanoid, OMA
C. elegans191743pmk-1Mitogen-activated protein kinase pmk-16239Inparanoid, OMA

Associated Recombinant Proteins

NomSpecification and purityExpression systemProtein labelDisponibilitéVoir les détails

Associated Antibodies

NomSpecificationsSpecies reactivityApplicationDisponibilitéVoir les détails

Associated Approved Drugs

    Associated Active Ligands

      Associated Diseases

      NomDirect Associated TargetsDisease TypeMondoid

      Bibliography

      Shall we send you a message when we have discounts available?

      Remind me later

      Thank you! Please check your email inbox to confirm.

      Oops! Notifications are disabled.