🌎 Ship to: United States
Basculer la navigation
Cart
Rechercher
Expédition le jour même pour tous les articles en stock.
Recherche Avancée
Commande rapide SDS / CoA Structure En vrac et personnalisé
Menu
Compte
Paramètres
྾
224,000+ produits de recherche · Triple ISO certified · COA & SDS disponible pour chaque produit · Expédition le jour même sur les articles en stock

CDC25C

DescriptionM-phase inducer phosphatase 3

Gene and Protein Information

Gene ID995
Uniprot Accession IDs P30307 D3DQB8 Q96PL3 Q9H168 Q9H2E8 Q9H2E9 Q9H2F1
Ensembl ID ENSP00000321656
Symbole CDC25 PPP1R60
FamilyBelongs to the MPI phosphatase family.
Sequence
MSTELFSSTREEGSSGSGPSFRSNQRKMLNLLLERDTSFTVCPDVPRTPVGKFLGDSANLSILSGGTPKRCLDLSNLSSGEITATQLTTSADLDETGHLDSSGLQEVHLAGMNHDQHLMKCSPAQLLCSTPNGLDRGHRKRDAMCSSSANKENDNGNLVDSEMKYLGSPITTVPKLDKNPNLGEDQAEEISDELMEFSLKDQEAKVSRSGLYRSPSMPENLNRPRLKQVEKFKDNTIPDKVKKKYFSGQGKLRKGLCLKKTVSLCDITITQMLEEDSNQGHLIGDFSKVCALPTVSGKHQDLKYVNPETVAALLSGKFQGLIEKFYVIDCRYPYEYLGGHIQGALNLYSQEELFNFFLKKPIVPLDTQKRIIIVFHCEFSSERGPRMCRCLREEDRSLNQYPALYYPELYILKGGYRDFFPEYMELCEPQSYCPMHHQDHKTELLRCRSQSKVQEGERQLREQIALLVKDMSP
Afficher plus
Homologous gene and protein info.
SpeciesGene IDGene SymbolNomNuméro d'identification fiscale Other Gene IDSources
Chimp746151CDC25Ccell division cycle 25C9598VGNC:3940OMA, EggNOG
Macaque714115CDC25Ccell division cycle 25C9544Inparanoid, OMA, EggNOG
Mouse12532Cdc25ccell division cycle 25C10090MGI:88350Inparanoid, OMA, EggNOG
Rat307511Cdc25ccell division cycle 25C10116RGD:1311875Inparanoid, OMA
Dog610456CDC25Ccell division cycle 25C9615VGNC:38991Inparanoid, OMA, EggNOG
Horse100062352CDC25Ccell division cycle 25C9796VGNC:16292Inparanoid, OMA, EggNOG
Cow507731CDC25Ccell division cycle 25C9913VGNC:27064Inparanoid, OMA, EggNOG
Pig100144474CDC25Ccell division cycle 25C9823Inparanoid, OMA, EggNOG
Opossum100025023CDC25Ccell division cycle 25C13616Inparanoid, EggNOG
Anole lizard100565034cdc25ccell division cycle 25C28377Inparanoid, OMA, EggNOG
Xenopus100124300cdc25ccell division cycle 25C8364XB-GENE-944821Inparanoid, OMA, EggNOG

Associated Recombinant Proteins

NomSpecification and purityExpression systemProtein labelDisponibilitéVoir les détails

Associated Antibodies

NomSpecificationsSpecies reactivityApplicationDisponibilitéVoir les détails

Associated Approved Drugs

    Associated Active Ligands

      Associated Diseases

      NomDirect Associated TargetsDisease TypeMondoid

      Bibliography

      🔙[Back to Target (Human)]
      We use cookies to ensure the website functions properly and, where permitted, to improve your experience. You can manage your preferences at any time in Settings. Learn more in our Cookie Policy.

      Shall we send you a message when we have discounts available?

      Remind me later

      Thank you! Please check your email inbox to confirm.

      Oops! Notifications are disabled.

      Privacy Policy Terms of Use Cookie Policy Terms and Conditions of Sale Sales Policy
      Products are supplied to verified businesses, institutions, and qualified professionals for research and development use only. Not for use in humans, animals, diagnosis, or therapy.
      Copyright © 2023–present Aladdin Scientific Corp. All rights reserved.