Basculer la navigation 
Rechercher
340,000+ produits de recherche · Triple ISO certified · COA & SDS disponible pour chaque produit · Expédition le jour même sur les articles en stock
| Description | P2X purinoceptor 1 |
|---|
Gene and Protein Information
| Gene ID | 5023 |
|---|---|
| Uniprot Accession IDs | P51575 Q9UK84 P2X1 |
| Ensembl ID | ENSP00000225538 |
| Symbole | P2X1 P2X1 |
| Family | Belongs to the P2X receptor family. |
| Sequence | MARRFQEELAAFLFEYDTPRMVLVRNKKVGVIFRLIQLVVLVYVIGWVFLYEKGYQTSSGLISSVSVKLKGLAVTQLPGLGPQVWDVADYVFPAQGDNSFVVMTNFIVTPKQTQGYCAEHPEGGICKEDSGCTPGKAKRKAQGIRTGKCVAFNDTVKTCEIFGWCPVEVDDDIPRPALLREAENFTLFIKNSISFPRFKVNRRNLVEEVNAAHMKTCLFHKTLHPLCPVFQLGYVVQESGQNFSTLAEKGGVVGITIDWHCDLDWHVRHCRPIYEFHGLYEEKNLSPGFNFRFARHFVENGTNYRHLFKVFGIRFDILVDGKAGKFDIIPTMTTIGSGIGIFGVATVLCDLLLLHILPKRHYYKQKKFKYAEDMGPGAAERDLAATSSTLGLQENMRTS Afficher plus |
Homologous gene and protein info.
| Species | Gene ID | Gene Symbol | Nom | Numéro d'identification fiscale | Other Gene ID | Sources |
|---|---|---|---|---|---|---|
| Chimp | 454439 | P2RX1 | purinergic receptor P2X 1 | 9598 | VGNC:9500 | OMA, EggNOG |
| Macaque | 707658 | P2RX1 | purinergic receptor P2X 1 | 9544 | Inparanoid, OMA, EggNOG | |
| Mouse | 18436 | P2rx1 | purinergic receptor P2X, ligand-gated ion channel, 1 | 10090 | MGI:1098235 | Inparanoid, OMA, EggNOG |
| Rat | 25505 | P2rx1 | purinergic receptor P2X 1 | 10116 | RGD:3240 | Inparanoid, OMA, EggNOG |
| Dog | 491223 | P2RX1 | purinergic receptor P2X 1 | 9615 | VGNC:44207 | Inparanoid, OMA, EggNOG |
| Horse | 100060689 | P2RX1 | purinergic receptor P2X 1 | 9796 | VGNC:21106 | Inparanoid, OMA, EggNOG |
| Cow | 514898 | P2RX1 | purinergic receptor P2X 1 | 9913 | VGNC:32517 | OMA, EggNOG |
| Pig | 106504105 | P2RX1 | purinergic receptor P2X 1 | 9823 | OMA, EggNOG | |
| Xenopus | P2RX1 | purinergic receptor P2X 1 [Source:HGNC Symbol;Acc:HGNC:8533] | 8364 | OMA, EggNOG | ||
| Zebrafish | 387296 | p2rx1 | purinergic receptor P2X, ligand-gated ion channel, 1 | 7955 | ZDB-GENE-030319-1 | Inparanoid, OMA, EggNOG |
Protein Classes
DTO Classes
protein / Ion channel / ATP-gated p2x receptor cation channel (p2x receptor) family / P2X purinoceptor 1
protein / Ion channel / ATP-gated p2x receptor cation channel (p2x receptor) family / P2X purinoceptor 1
Associated Recombinant Proteins
| Nom | Specification and purity | Expression system | Protein label | Disponibilité | Voir les détails |
|---|
Associated Antibodies
| Nom | Spécifications | Species reactivity | Application | Disponibilité | Voir les détails |
|---|
Associated Approved Drugs
Associated Active Ligands
Associated Diseases
| Nom | Direct Associated Targets | Disease Type | Mondoid |
|---|
Bibliography
Me rappeler plus tard
Products are supplied to verified businesses, institutions, and qualified professionals for research and development use only. Not for use in humans, animals, diagnosis, or therapy.
Copyright © 2023–present Aladdin Scientific Corporation. All rights reserved.