🌎 Ship to: United States
Basculer la navigation
Cart
Rechercher
Expédition le jour même pour tous les articles en stock.
Recherche Avancée
Commande rapide SDS CoA Structure
Menu
Compte
Paramètres
྾
224,000+ produits de recherche · Triple ISO certified · COA & SDS disponible pour chaque produit · Expédition le jour même sur les articles en stock

P2RX1

DescriptionP2X purinoceptor 1

Gene and Protein Information

Gene ID5023
Uniprot Accession IDs P51575 Q9UK84 P2X1
Ensembl ID ENSP00000225538
Symbole P2X1 P2X1
FamilyBelongs to the P2X receptor family.
Sequence
MARRFQEELAAFLFEYDTPRMVLVRNKKVGVIFRLIQLVVLVYVIGWVFLYEKGYQTSSGLISSVSVKLKGLAVTQLPGLGPQVWDVADYVFPAQGDNSFVVMTNFIVTPKQTQGYCAEHPEGGICKEDSGCTPGKAKRKAQGIRTGKCVAFNDTVKTCEIFGWCPVEVDDDIPRPALLREAENFTLFIKNSISFPRFKVNRRNLVEEVNAAHMKTCLFHKTLHPLCPVFQLGYVVQESGQNFSTLAEKGGVVGITIDWHCDLDWHVRHCRPIYEFHGLYEEKNLSPGFNFRFARHFVENGTNYRHLFKVFGIRFDILVDGKAGKFDIIPTMTTIGSGIGIFGVATVLCDLLLLHILPKRHYYKQKKFKYAEDMGPGAAERDLAATSSTLGLQENMRTS
Afficher plus
Homologous gene and protein info.
SpeciesGene IDGene SymbolNomNuméro d'identification fiscale Other Gene IDSources
Chimp454439P2RX1purinergic receptor P2X 19598VGNC:9500OMA, EggNOG
Macaque707658P2RX1purinergic receptor P2X 19544Inparanoid, OMA, EggNOG
Mouse18436P2rx1purinergic receptor P2X, ligand-gated ion channel, 110090MGI:1098235Inparanoid, OMA, EggNOG
Rat25505P2rx1purinergic receptor P2X 110116RGD:3240Inparanoid, OMA, EggNOG
Dog491223P2RX1purinergic receptor P2X 19615VGNC:44207Inparanoid, OMA, EggNOG
Horse100060689P2RX1purinergic receptor P2X 19796VGNC:21106Inparanoid, OMA, EggNOG
Cow514898P2RX1purinergic receptor P2X 19913VGNC:32517OMA, EggNOG
Pig106504105P2RX1purinergic receptor P2X 19823OMA, EggNOG
XenopusP2RX1purinergic receptor P2X 1 [Source:HGNC Symbol;Acc:HGNC:8533]8364OMA, EggNOG
Zebrafish387296p2rx1purinergic receptor P2X, ligand-gated ion channel, 17955ZDB-GENE-030319-1Inparanoid, OMA, EggNOG

Protein Classes

DTO Classes
protein    /    Ion channel    /    ATP-gated p2x receptor cation channel (p2x receptor) family    /    P2X purinoceptor 1

Associated Recombinant Proteins

NomSpecification and purityExpression systemProtein labelDisponibilitéVoir les détails

Associated Antibodies

NomSpecificationsSpecies reactivityApplicationDisponibilitéVoir les détails

Associated Approved Drugs

    Associated Active Ligands

      Associated Diseases

      NomDirect Associated TargetsDisease TypeMondoid

      Bibliography

      🔙[Back to Target (Human)]
      We use cookies to ensure the website functions properly and, where permitted, to improve your experience. You can manage your preferences at any time in Settings. Learn more in our Cookie Policy.

      Shall we send you a message when we have discounts available?

      Remind me later

      Thank you! Please check your email inbox to confirm.

      Oops! Notifications are disabled.

      Privacy Policy Terms of Use Cookie Policy Terms and Conditions of Sale Sales Policy
      Products are supplied to verified businesses, institutions, and qualified professionals for research and development use only. Not for use in humans, animals, diagnosis, or therapy.
      Copyright © 2023–present Aladdin Scientific Corp. All rights reserved.