Basculer la navigation 
Rechercher
340,000+ produits de recherche · Triple ISO certified · COA & SDS disponible pour chaque produit · Expédition le jour même sur les articles en stock
| Description | Nucleolar GTP-binding protein 1 |
|---|
Gene and Protein Information
| Gene ID | 23560 |
|---|---|
| Uniprot Accession IDs | Q9BZE4 B3KMC5 B4DY13 B7Z7A3 O95446 Q5T3R8 Q9NVJ8 |
| Ensembl ID | ENSP00000354040 |
| Symbole | CRFG NOG1 NGB CRFG NOG1 |
| Family | Belongs to the TRAFAC class OBG-HflX-like GTPase superfamily. OBG GTPase family. NOG subfamily. |
| Sequence | MAHYNFKKITVVPSAKDFIDLTLSKTQRKTPTVIHKHYQIHRIRHFYMRKVKFTQQNYHDRLSQILTDFPKLDDIHPFYADLMNILYDKDHYKLALGQINIAKNLVDNVAKDYVRLMKYGDSLYRCKQLKRAALGRMCTVIKRQKQSLEYLEQVRQHLSRLPTIDPNTRTLLLCGYPNVGKSSFINKVTRADVDVQPYAFTTKSLFVGHMDYKYLRWQVVDTPGILDHPLEDRNTIEMQAITALAHLRAAVLYVMDLSEQCGHGLREQLELFQNIRPLFINKPLIVVANKCDVKRIAELSEDDQKIFTDLQSEGFPVIETSTLTEEGVIKVKTEACDRLLAHRVETKMKGNKVNEVLNRLHLAIPTRRDDKERPPFIPEGVVARRKRMETEESRKKRERDLELEMGDDYILDLQKYWDLMNLSEKHDKIPEIWEGHNIADYIDPAIMKKLEELEKEEELRTAAGEYDSVSESEDEEMLEIRQLAKQIREKKKLKILESKEKNTQGPRMPRTAKKVQRTVLEKEMRSLGVDMDDKDDAHYAVQARRSRSITRKRKREDSAPPSSVARSGSCSRTPRDVSGLRDVKMVKKAKTMMKNAQKKMNRLGKKGEADRHVFDMKPKHLLSGKRKAGKKDRR Afficher plus |
Homologous gene and protein info.
| Species | Gene ID | Gene Symbol | Nom | Numéro d'identification fiscale | Other Gene ID | Sources |
|---|---|---|---|---|---|---|
| Chimp | 450261 | GTPBP4 | GTP binding protein 4 | 9598 | VGNC:4701 | Inparanoid, OMA, EggNOG |
| Macaque | 709873 | GTPBP4 | GTP binding protein 4 | 9544 | OMA, EggNOG | |
| Mouse | 69237 | Gtpbp4 | GTP binding protein 4 | 10090 | MGI:1916487 | Inparanoid, OMA, EggNOG |
| Rat | 114300 | Gtpbp4 | GTP binding protein 4 | 10116 | RGD:620783 | Inparanoid, OMA, EggNOG |
| Dog | 478021 | GTPBP4 | GTP binding protein 4 | 9615 | VGNC:49777 | Inparanoid, OMA, EggNOG |
| Horse | 100071237 | GTPBP4 | GTP binding protein 4 | 9796 | VGNC:18652 | Inparanoid, OMA, EggNOG |
| Cow | 524743 | GTPBP4 | GTP binding protein 4 | 9913 | VGNC:29710 | Inparanoid, OMA, EggNOG |
| Pig | 100625226 | GTPBP4 | GTP binding protein 4 | 9823 | Inparanoid, OMA | |
| Opossum | 100017256 | GTPBP4 | GTP binding protein 4 | 13616 | Inparanoid, OMA, EggNOG | |
| Chicken | 420458 | GTPBP4 | GTP binding protein 4 | 9031 | CGNC:5061 | Inparanoid, OMA, EggNOG |
| Anole lizard | 100559003 | gtpbp4 | GTP binding protein 4 | 28377 | Inparanoid, OMA, EggNOG | |
| Xenopus | 496593 | gtpbp4 | GTP binding protein 4 | 8364 | XB-GENE-962819 | Inparanoid, OMA, EggNOG |
| Zebrafish | 334050 | gtpbp4 | GTP binding protein 4 | 7955 | ZDB-GENE-030131-5982 | Inparanoid, OMA, EggNOG |
| C. elegans | 176863 | nog-1 | Nucleolar GTP-binding protein 1 | 6239 | Inparanoid, OMA, EggNOG | |
| Fruitfly | 35963 | Non1 | Novel nucleolar protein 1 | 7227 | FBgn0028473 | Inparanoid, EggNOG |
| S.cerevisiae | 856012 | NOG1 | putative GTPase NOG1 | 4932 | S000006014 | Inparanoid, OMA, EggNOG |
Associated Recombinant Proteins
| Nom | Specification and purity | Expression system | Protein label | Disponibilité | Voir les détails |
|---|
Associated Antibodies
| Nom | Specifications | Species reactivity | Application | Disponibilité | Voir les détails |
|---|
Associated Approved Drugs
Associated Active Ligands
Associated Diseases
| Nom | Direct Associated Targets | Disease Type | Mondoid |
|---|
Bibliography
Me rappeler plus tard
Products are supplied to verified businesses, institutions, and qualified professionals for research and development use only. Not for use in humans, animals, diagnosis, or therapy.
Copyright © 2023–present Aladdin Scientific Corporation. All rights reserved.