NPBWR2

DescriptionNeuropeptides B/W receptor type 2

Gene and Protein Information

Gene ID2832
Uniprot Accession IDs P48146 Q6NWQ6 Q9H4K3
Ensembl ID ENSP00000358783
Symbole GPR8 GPR8
FamilyBelongs to the G-protein coupled receptor 1 family.
Sequence
MQAAGHPEPLDSRGSFSLPTMGANVSQDNGTGHNATFSEPLPFLYVLLPAVYSGICAVGLTGNTAVILVILRAPKMKTVTNVFILNLAVADGLFTLVLPVNIAEHLLQYWPFGELLCKLVLAVDHYNIFSSIYFLAVMSVDRYLVVLATVRSRHMPWRTYRGAKVASLCVWLGVTVLVLPFFSFAGVYSNELQVPSCGLSFPWPEQVWFKASRVYTLVLGFVLPVCTICVLYTDLLRRLRAVRLRSGAKALGKARRKVTVLVLVVLAVCLLCWTPFHLASVVALTTDLPQTPLVISMSYVITSLSYANSCLNPFLYAFLDDNFRKNFRSILRC
Afficher plus
Homologous gene and protein info.
SpeciesGene IDGene SymbolNomNuméro d'identification fiscale Other Gene IDSources
Macaque719200NPBWR2neuropeptides B and W receptor 29544Inparanoid, OMA, EggNOG
Horse100051823NPBWR2neuropeptides B and W receptor 29796VGNC:20830Inparanoid, OMA
Anole lizard100562082npbwr2neuropeptides B and W receptor 228377Inparanoid, OMA

Protein Classes

PANTHER Classes
protein    /    receptor    /    G-protein coupled receptor    /    Neuropeptides b/w receptor type 2
DTO Classes
protein    /    G-protein coupled receptor    /    Class A rhodopsin like    /    Neuropeptide W/neuropeptide B receptor    /    Neuropeptides b/w receptor type 2

Associated Recombinant Proteins

NomSpecification and purityExpression systemProtein labelDisponibilitéVoir les détails

Associated Antibodies

NomSpecificationsSpecies reactivityApplicationDisponibilitéVoir les détails

Associated Approved Drugs

    Associated Active Ligands

      Associated Diseases

      NomDirect Associated TargetsDisease TypeMondoid

      Bibliography

      Shall we send you a message when we have discounts available?

      Remind me later

      Thank you! Please check your email inbox to confirm.

      Oops! Notifications are disabled.