Basculer la navigation 
Rechercher
340,000+ produits de recherche · Triple ISO certified · COA & SDS disponible pour chaque produit · Expédition le jour même sur les articles en stock
| Description | Cysteine and glycine-rich protein 1 |
|---|
Gene and Protein Information
| Gene ID | 1465 |
|---|---|
| Uniprot Accession IDs | P21291 A8K268 Q5U0J2 |
| Ensembl ID | ENSP00000356275 |
| Symbole | CSRP CYRP CRP CRP1 CSRP CYRP D1S181E HEL-141 HEL-S-286 |
| Sequence | MPNWGGGKKCGVCQKTVYFAEEVQCEGNSFHKSCFLCMVCKKNLDSTTVAVHGEEIYCKSCYGKKYGPKGYGYGQGAGTLSTDKGESLGIKHEEAPGHRPTTNPNASKFAQKIGGSERCPRCSQAVYAAEKVIGAGKSWHKACFRCAKCGKGLESTTLADKDGEIYCKGCYAKNFGPKGFGFGQGAGALVHSE |
Homologous gene and protein info.
| Species | Gene ID | Gene Symbol | Nom | Numéro d'identification fiscale | Other Gene ID | Sources |
|---|---|---|---|---|---|---|
| Chimp | 457621 | CSRP1 | cysteine and glycine rich protein 1 | 9598 | VGNC:6739 | OMA, EggNOG |
| Macaque | 709693 | CSRP1 | cysteine and glycine rich protein 1 | 9544 | Inparanoid, OMA | |
| Mouse | 13007 | Csrp1 | cysteine and glycine-rich protein 1 | 10090 | MGI:88549 | Inparanoid, OMA, EggNOG |
| Rat | 29276 | Csrp1 | cysteine and glycine-rich protein 1 | 10116 | RGD:62053 | Inparanoid, OMA |
| Dog | 607054 | CSRP1 | cysteine and glycine rich protein 1 | 9615 | VGNC:39675 | Inparanoid, OMA |
| Horse | 100051956 | CSRP1 | cysteine and glycine rich protein 1 | 9796 | VGNC:16913 | Inparanoid, OMA |
| Cow | 615329 | CSRP1 | cysteine and glycine rich protein 1 | 9913 | VGNC:27773 | Inparanoid, OMA |
| Opossum | CSRP1 | cysteine and glycine rich protein 1 [Source:HGNC Symbol;Acc:HGNC:2469] | 13616 | Inparanoid, OMA | ||
| Chicken | 396176 | CSRP1 | cysteine and glycine rich protein 1 | 9031 | CGNC:188 | Inparanoid, OMA |
| Anole lizard | 100565898 | csrp1 | cysteine and glycine rich protein 1 | 28377 | Inparanoid, OMA | |
| Xenopus | 448688 | csrp1 | cysteine and glycine rich protein 1 | 8364 | XB-GENE-941448 | Inparanoid, OMA |
| Zebrafish | 791132 | csrp1b | cysteine and glycine-rich protein 1b | 7955 | ZDB-GENE-070112-252 | Inparanoid, OMA |
Protein Classes
PANTHER Classes
protein / cytoskeletal protein / actin family cytoskeletal protein / Cysteine and glycine-rich protein 1
protein / cytoskeletal protein / actin family cytoskeletal protein / Cysteine and glycine-rich protein 1
DTO Classes
protein / Cellular structure / Actin family cytoskeletal protein / Cysteine and glycine-rich protein 1
protein / Cellular structure / Actin family cytoskeletal protein / Cysteine and glycine-rich protein 1
Associated Recombinant Proteins
| Nom | Specification and purity | Expression system | Protein label | Disponibilité | Voir les détails |
|---|
Associated Antibodies
| Nom | Spécifications | Species reactivity | Application | Disponibilité | Voir les détails |
|---|
Associated Approved Drugs
Associated Active Ligands
Associated Diseases
| Nom | Direct Associated Targets | Disease Type | Mondoid |
|---|
Bibliography
Me rappeler plus tard
Products are supplied to verified businesses, institutions, and qualified professionals for research and development use only. Not for use in humans, animals, diagnosis, or therapy.
Copyright © 2023–present Aladdin Scientific Corporation. All rights reserved.