NPBWR1

DescriptionNeuropeptides B/W receptor type 1

Gene and Protein Information

Gene ID2831
Uniprot Accession IDs P48145 Q6NTC7
Ensembl ID ENSP00000330284
Symbole GPR7 GPR7
FamilyBelongs to the G-protein coupled receptor 1 family.
Sequence
MDNASFSEPWPANASGPDPALSCSNASTLAPLPAPLAVAVPVVYAVICAVGLAGNSAVLYVLLRAPRMKTVTNLFILNLAIADELFTLVLPINIADFLLRQWPFGELMCKLIVAIDQYNTFSSLYFLTVMSADRYLVVLATAESRRVAGRTYSAARAVSLAVWGIVTLVVLPFAVFARLDDEQGRRQCVLVFPQPEAFWWRASRLYTLVLGFAIPVSTICVLYTTLLCRLHAMRLDSHAKALERAKKRVTFLVVAILAVCLLCWTPYHLSTVVALTTDLPQTPLVIAISYFITSLSYANSCLNPFLYAFLDASFRRNLRQLITCRAAA
Afficher plus
Homologous gene and protein info.
SpeciesGene IDGene SymbolNomNuméro d'identification fiscale Other Gene IDSources
Chimp739992NPBWR1neuropeptides B and W receptor 19598VGNC:14637OMA, EggNOG
Macaque710519NPBWR1neuropeptides B and W receptor 19544Inparanoid, EggNOG
Mouse226304Npbwr1neuropeptides B/W receptor 110090MGI:891989Inparanoid, OMA, EggNOG
Rat297795Npbwr1neuropeptides B and W receptor 110116RGD:1305917Inparanoid, OMA, EggNOG
Dog486949NPBWR1neuropeptides B and W receptor 19615VGNC:43912Inparanoid, OMA, EggNOG
Cow281207NPBWR1neuropeptides B and W receptor 19913VGNC:32193Inparanoid, OMA, EggNOG
Pig100628123NPBWR1neuropeptides B and W receptor 19823OMA, EggNOG
Opossum100030316NPBWR1neuropeptides B and W receptor 113616Inparanoid, OMA
Chicken421117NPBWR1neuropeptides B/W receptor 19031CGNC:11358Inparanoid, OMA, EggNOG
Anole lizardNPBWR1neuropeptides B and W receptor 1 [Source:HGNC Symbol;Acc:HGNC:4522]28377Inparanoid, OMA
Xenopusnpbwr1neuropeptides B/W receptor 1 [Source:Xenbase;Acc:XB-GENE-984596]8364OMA, EggNOG

Protein Classes

PANTHER Classes
protein    /    receptor    /    G-protein coupled receptor    /    Neuropeptides B/W receptor type 1
DTO Classes
protein    /    G-protein coupled receptor    /    Class A rhodopsin like    /    Neuropeptide W/neuropeptide B receptor    /    Neuropeptides B/W receptor type 1

Associated Recombinant Proteins

NomSpecification and purityExpression systemProtein labelDisponibilitéVoir les détails

Associated Antibodies

NomSpecificationsSpecies reactivityApplicationDisponibilitéVoir les détails

Associated Approved Drugs

    Associated Active Ligands

      Associated Diseases

      NomDirect Associated TargetsDisease TypeMondoid

      Bibliography

      Shall we send you a message when we have discounts available?

      Remind me later

      Thank you! Please check your email inbox to confirm.

      Oops! Notifications are disabled.