Basculer la navigation 
Rechercher
340,000+ produits de recherche · Triple ISO certified · COA & SDS disponible pour chaque produit · Expédition le jour même sur les articles en stock
| Description | CCR4-NOT transcription complex subunit 4 |
|---|
Gene and Protein Information
| Gene ID | 4850 |
|---|---|
| Uniprot Accession IDs | O95628 B7Z6I4 E7ET38 F8VQP3 O95339 O95627 Q8IYM7 Q8NCL0 Q9NPQ1 Q9NZN6 |
| Ensembl ID | ENSP00000445508 |
| Symbole | NOT4 NOT4 NOT4H CLONE243 |
| Sequence | MSRSPDAKEDPVECPLCMEPLEIDDINFFPCTCGYQICRFCWHRIRTDENGLCPACRKPYPEDPAVYKPLSQEELQRIKNEKKQKQNERKQKISENRKHLASVRVVQKNLVFVVGLSQRLADPEVLKRPEYFGKFGKIHKVVINNSTSYAGSQGPSASAYVTYIRSEDALRAIQCVNNVVVDGRTLKASLGTTKYCSYFLKNMQCPKPDCMYLHELGDEAASFTKEEMQAGKHQEYEQKLLQELYKLNPNFLQLSTGSVDKNKNKVTPLQRYDTPIDKPSDSLSIGNGDNSQQISNSDTPSPPPGLSKSNPVIPISSSNHSARSPFEGAVTESQSLFSDNFRHPNPIPSGLPPFPSSPQTSSDWPTAPEPQSLFTSETIPVSSSTDWQAAFGFGSSKQPEDDLGFDPFDVTRKALADLIEKELSVQDQPSLSPTSLQNSSSHTTTAKGPGSGFLHPAAATNANSLNSTFSVLPQRFPQFQQHRAVYNSFSFPGQAARYPWMAFPRNSIMHLNHTANPTSNSNFLDLNLPPQHNTGLGGIPVAGEEEVKVSTMPLSTSSHSLQQGQQPTSLHTTVA Afficher plus |
Homologous gene and protein info.
| Species | Gene ID | Gene Symbol | Nom | Numéro d'identification fiscale | Other Gene ID | Sources |
|---|---|---|---|---|---|---|
| Chimp | 463751 | CNOT4 | CCR4-NOT transcription complex subunit 4 | 9598 | VGNC:7368 | OMA, EggNOG |
| Macaque | 708011 | CNOT4 | CCR4-NOT transcription complex subunit 4 | 9544 | Inparanoid, OMA, EggNOG | |
| Mouse | 53621 | Cnot4 | CCR4-NOT transcription complex, subunit 4 | 10090 | MGI:1859026 | Inparanoid, OMA, EggNOG |
| Rat | 312227 | Cnot4 | CCR4-NOT transcription complex, subunit 4 | 10116 | RGD:1310318 | Inparanoid, OMA, EggNOG |
| Dog | 482708 | CNOT4 | CCR4-NOT transcription complex subunit 4 | 9615 | VGNC:39415 | Inparanoid, OMA, EggNOG |
| Horse | 100065026 | CNOT4 | CCR4-NOT transcription complex subunit 4 | 9796 | VGNC:16677 | Inparanoid, OMA, EggNOG |
| Cow | 540891 | CNOT4 | CCR4-NOT transcription complex subunit 4 | 9913 | VGNC:27519 | Inparanoid, OMA, EggNOG |
| Opossum | 100016711 | CNOT4 | CCR4-NOT transcription complex subunit 4 | 13616 | Inparanoid, OMA, EggNOG | |
| Platypus | 100081604 | CNOT4 | CCR4-NOT transcription complex subunit 4 | 9258 | Inparanoid, OMA, EggNOG | |
| Chicken | 417936 | CNOT4 | CCR4-NOT transcription complex subunit 4 | 9031 | CGNC:8877 | Inparanoid, OMA, EggNOG |
| Anole lizard | 100553912 | cnot4 | CCR4-NOT transcription complex subunit 4 | 28377 | Inparanoid, OMA, EggNOG | |
| Xenopus | 594959 | cnot4 | CCR4-NOT transcription complex subunit 4 | 8364 | XB-GENE-947788 | Inparanoid, OMA, EggNOG |
| Fruitfly | 34416 | Cnot4 | CCR4-NOT transcription complex subunit 4 | 7227 | FBgn0051716 | Inparanoid, EggNOG |
| S.cerevisiae | 856799 | MOT2 | CCR4-NOT core ubiquitin-protein ligase subunit MOT2 | 4932 | S000000870 | Inparanoid, EggNOG |
Associated Recombinant Proteins
| Nom | Specification and purity | Expression system | Protein label | Disponibilité | Voir les détails |
|---|
Associated Antibodies
| Nom | Spécifications | Species reactivity | Application | Disponibilité | Voir les détails |
|---|
Associated Approved Drugs
Associated Active Ligands
Associated Diseases
| Nom | Direct Associated Targets | Disease Type | Mondoid |
|---|
Bibliography
Me rappeler plus tard
Products are supplied to verified businesses, institutions, and qualified professionals for research and development use only. Not for use in humans, animals, diagnosis, or therapy.
Copyright © 2023–present Aladdin Scientific Corporation. All rights reserved.