Basculer la navigation 
Rechercher
340,000+ produits de recherche · Triple ISO certified · COA & SDS disponible pour chaque produit · Expédition le jour même sur les articles en stock
| Description | Cyclin-dependent kinase 9 |
|---|
Gene and Protein Information
| Gene ID | 1025 |
|---|---|
| Uniprot Accession IDs | P50750 Q5JU24 Q5JU25 Q5U006 Q96TF1 |
| Ensembl ID | ENSP00000362361 |
| Symbole | CDC2L4 TAK TAK C-2k CTK1 CDC2L4 PITALRE |
| Family | Belongs to the protein kinase superfamily. CMGC Ser/Thr protein kinase family. CDC2/CDKX subfamily. |
| Sequence | MAKQYDSVECPFCDEVSKYEKLAKIGQGTFGEVFKARHRKTGQKVALKKVLMENEKEGFPITALREIKILQLLKHENVVNLIEICRTKASPYNRCKGSIYLVFDFCEHDLAGLLSNVLVKFTLSEIKRVMQMLLNGLYYIHRNKILHRDMKAANVLITRDGVLKLADFGLARAFSLAKNSQPNRYTNRVVTLWYRPPELLLGERDYGPPIDLWGAGCIMAEMWTRSPIMQGNTEQHQLALISQLCGSITPEVWPNVDNYELYEKLELVKGQKRKVKDRLKAYVRDPYALDLIDKLLVLDPAQRIDSDDALNHDFFWSDPMPSDLKGMLSTHLTSMFEYLAPPRRKGSQITQQSTNQSRNPATTNQTEFERVF Afficher plus |
Homologous gene and protein info.
| Species | Gene ID | Gene Symbol | Nom | Numéro d'identification fiscale | Other Gene ID | Sources |
|---|---|---|---|---|---|---|
| Chimp | 464755 | CDK9 | cyclin dependent kinase 9 | 9598 | VGNC:8807 | OMA, EggNOG |
| Mouse | 107951 | Cdk9 | cyclin-dependent kinase 9 (CDC2-related kinase) | 10090 | MGI:1328368 | Inparanoid, OMA, EggNOG |
| Rat | 362110 | Cdk9 | cyclin-dependent kinase 9 | 10116 | RGD:1359638 | Inparanoid, OMA |
| Dog | 100855805 | CDK9 | cyclin dependent kinase 9 | 9615 | VGNC:39062 | Inparanoid, OMA, EggNOG |
| Horse | 100070437 | CDK9 | cyclin dependent kinase 9 | 9796 | VGNC:16357 | Inparanoid, OMA, EggNOG |
| Cow | 520580 | CDK9 | cyclin dependent kinase 9 | 9913 | VGNC:27136 | Inparanoid, OMA, EggNOG |
| Pig | 100307051 | CDK9 | cyclin dependent kinase 9 | 9823 | Inparanoid, OMA, EggNOG | |
| Opossum | 100010850 | CDK9 | cyclin dependent kinase 9 | 13616 | Inparanoid, EggNOG | |
| Xenopus | 448039 | cdk9 | cyclin-dependent kinase 9 | 8364 | XB-GENE-483721 | Inparanoid, OMA, EggNOG |
| Zebrafish | 321602 | cdk9 | cyclin-dependent kinase 9 (CDC2-related kinase) | 7955 | ZDB-GENE-030131-321 | Inparanoid, OMA, EggNOG |
| C. elegans | 173023 | cdk-9 | Probable cyclin-dependent kinase 9 | 6239 | Inparanoid, OMA |
Associated Recombinant Proteins
| Nom | Specification and purity | Expression system | Protein label | Disponibilité | Voir les détails |
|---|
Associated Antibodies
| Nom | Spécifications | Species reactivity | Application | Disponibilité | Voir les détails |
|---|
Associated Approved Drugs
Associated Active Ligands
Associated Diseases
| Nom | Direct Associated Targets | Disease Type | Mondoid |
|---|
Bibliography
Me rappeler plus tard
Products are supplied to verified businesses, institutions, and qualified professionals for research and development use only. Not for use in humans, animals, diagnosis, or therapy.
Copyright © 2023–present Aladdin Scientific Corporation. All rights reserved.