CTSE

DescriptionCathepsin E

Gene and Protein Information

Gene ID1510
Uniprot Accession IDs P14091 Q5TZ01 Q5TZ02 Q9NY58 Q9UCE3 Q9UCE4
Ensembl ID ENSP00000350911
Symbole CATE
FamilyBelongs to the peptidase A1 family.
Sequence
MKTLLLLLLVLLELGEAQGSLHRVPLRRHPSLKKKLRARSQLSEFWKSHNLDMIQFTESCSMDQSAKEPLINYLDMEYFGTISIGSPPQNFTVIFDTGSSNLWVPSVYCTSPACKTHSRFQPSQSSTYSQPGQSFSIQYGTGSLSGIIGADQVSVEGLTVVGQQFGESVTEPGQTFVDAEFDGILGLGYPSLAVGGVTPVFDNMMAQNLVDLPMFSVYMSSNPEGGAGSELIFGGYDHSHFSGSLNWVPVTKQAYWQIALDNIQVGGTVMFCSEGCQAIVDTGTSLITGPSDKIKQLQNAIGAAPVDGEYAVECANLNVMPDVTFTINGVPYTLSPTAYTLLDFVDGMQFCSSGFQGLDIHPPAGPLWILGDVFIRQFYSVFDRGNNRVGLAPAVP
Afficher plus
Homologous gene and protein info.
SpeciesGene IDGene SymbolNomNuméro d'identification fiscale Other Gene IDSources
Chimp457677CTSEcathepsin E9598VGNC:514OMA, EggNOG
Macaque696202CTSEcathepsin E9544Inparanoid, OMA
Mouse13034Ctsecathepsin E10090MGI:107361Inparanoid, OMA, EggNOG
Rat25424Ctsecathepsin E10116RGD:2446Inparanoid, OMA, EggNOG
Dog488577CTSEcathepsin E9615VGNC:39710Inparanoid, OMA
Horse100055161CTSEcathepsin E9796VGNC:16950Inparanoid, OMA, EggNOG
Opossum100019361CTSEcathepsin E13616Inparanoid, OMA, EggNOG
Chicken771791CTSEcathepsin E9031CGNC:503Inparanoid, OMA
Anole lizard100561705ctsecathepsin E28377Inparanoid, OMA, EggNOG
Xenopus100145572ctsecathepsin E8364XB-GENE-947864Inparanoid, OMA
S.cerevisiae855949PEP4proteinase A4932S000006075OMA, EggNOG

Associated Recombinant Proteins

NomSpecification and purityExpression systemProtein labelDisponibilitéVoir les détails

Associated Antibodies

NomSpecificationsSpecies reactivityApplicationDisponibilitéVoir les détails

Associated Approved Drugs

    Associated Active Ligands

      Associated Diseases

      NomDirect Associated TargetsDisease TypeMondoid

      Bibliography

      Shall we send you a message when we have discounts available?

      Remind me later

      Thank you! Please check your email inbox to confirm.

      Oops! Notifications are disabled.