🌎 Livrer à: United States
Basculer la navigation
Panier
Rechercher
Expédition le jour même pour tous les articles en stock.
Recherche Avancée
Commande rapide SDS / CoA Structure En vrac et personnalisé
Menu
Compte
Paramètres
྾
340,000+ produits de recherche · Triple ISO certified · COA & SDS disponible pour chaque produit · Expédition le jour même sur les articles en stock

CDK18

DescriptionCyclin-dependent kinase 18

Gene and Protein Information

Gene ID5129
Uniprot Accession IDs Q07002 Q5VXQ2 Q6V3A2 Q6V3A3 Q96F90
Ensembl ID ENSP00000423665
Symbole PCTAIRE3 PCTK3 PCTK3 PCTAIRE PCTAIRE3
FamilyBelongs to the protein kinase superfamily. CMGC Ser/Thr protein kinase family. CDC2/CDKX subfamily.
Sequence
MIMNKMKNFKRRFSLSVPRTETIEESLAEFTEQFNQLHNRRNENLQLGPLGRDPPQECSTFSPTDSGEEPGQLSPGVQFQRRQNQRRFSMEDVSKRLSLPMDIRLPQEFLQKLQMESPDLPKPLSRMSRRASLSDIGFGKLETYVKLDKLGEGTYATVFKGRSKLTENLVALKEIRLEHEEGAPCTAIREVSLLKNLKHANIVTLHDLIHTDRSLTLVFEYLDSDLKQYLDHCGNLMSMHNVKIFMFQLLRGLAYCHHRKILHRDLKPQNLLINERGELKLADFGLARAKSVPTKTYSNEVVTLWYRPPDVLLGSTEYSTPIDMWGVGCIHYEMATGRPLFPGSTVKEELHLIFRLLGTPTEETWPGVTAFSEFRTYSFPCYLPQPLINHAPRLDTDGIHLLSSLLLYESKSRMSAEAALSHSYFRSLGERVHQLEDTASIFSLKEIQLQKDPGYRGLAFQQPGRGKNRRQSIF
Afficher plus
Homologous gene and protein info.
SpeciesGene IDGene SymbolNomNuméro d'identification fiscale Other Gene IDSources
Macaque100430417CDK18cyclin dependent kinase 189544Inparanoid, OMA, EggNOG
Mouse18557Cdk18cyclin-dependent kinase 1810090MGI:97518Inparanoid, OMA, EggNOG
Rat289019Cdk18cyclin-dependent kinase 1810116RGD:1309523Inparanoid, OMA, EggNOG
Dog488573CDK18cyclin dependent kinase 189615VGNC:39049Inparanoid, OMA, EggNOG
Horse100050250CDK18cyclin dependent kinase 189796VGNC:16344Inparanoid, OMA, EggNOG
Cow534048CDK18cyclin dependent kinase 189913VGNC:27121OMA, EggNOG
Opossum100014165CDK18cyclin dependent kinase 1813616Inparanoid, OMA, EggNOG
Chicken771736CDK18cyclin dependent kinase 189031CGNC:437OMA, EggNOG
Anole lizard100564067cdk18cyclin dependent kinase 1828377Inparanoid, OMA, EggNOG
Xenopus448581cdk18cyclin-dependent kinase 188364XB-GENE-489094OMA, EggNOG
Zebrafish100150007si:dkey-166c18.1si:dkey-166c18.17955ZDB-GENE-141215-51OMA, EggNOG

Associated Recombinant Proteins

NomSpecification and purityExpression systemProtein labelDisponibilitéVoir les détails

Associated Antibodies

NomSpécificationsSpecies reactivityApplicationDisponibilitéVoir les détails

Associated Approved Drugs

    Associated Active Ligands

      Associated Diseases

      NomDirect Associated TargetsDisease TypeMondoid

      Bibliography

      🔙[Back to Target (Human)]
      Nous utilisons des cookies pour garantir le bon fonctionnement du site et, lorsque cela est autorisé, pour améliorer votre expérience. Vous pouvez gérer vos préférences à tout moment dans les Paramètres. Pour en savoir plus, consultez notre Politique relative aux cookies.

      Souhaitez-vous que nous vous envoyions un message lorsque des réductions seront disponibles?

      Me rappeler plus tard

      Merci ! Veuillez vérifier votre boîte de réception e-mail pour confirmer.

      Oups ! Les notifications sont désactivées.

      Privacy Policy Terms of Use Cookie Policy Terms and Conditions of Sale Sales Policy
      Products are supplied to verified businesses, institutions, and qualified professionals for research and development use only. Not for use in humans, animals, diagnosis, or therapy.
      Copyright © 2023–present Aladdin Scientific Corporation. All rights reserved.