🌎 Ship to: United States
Basculer la navigation
Cart
Rechercher
Expédition le jour même pour tous les articles en stock.
Recherche Avancée
Commande rapide SDS CoA Structure
Menu
Compte
Paramètres
྾
224,000+ produits de recherche · Triple ISO certified · COA & SDS disponible pour chaque produit · Expédition le jour même sur les articles en stock

CD14

DescriptionMonocyte differentiation antigen CD14

Gene and Protein Information

Gene ID929
Uniprot Accession IDs P08571 Q53XT5 Q96FR6 Q96L99 Q9UNS3
Ensembl ID ENSP00000304236
Sequence
MERASCLLLLLLPLVHVSATTPEPCELDDEDFRCVCNFSEPQPDWSEAFQCVSAVEVEIHAGGLNLEPFLKRVDADADPRQYADTVKALRVRRLTVGAAQVPAQLLVGALRVLAYSRLKELTLEDLKITGTMPPLPLEATGLALSSLRLRNVSWATGRSWLAELQQWLKPGLKVLSIAQAHSPAFSCEQVRAFPALTSLDLSDNPGLGERGLMAALCPHKFPAIQNLALRNTGMETPTGVCAALAAAGVQPHSLDLSHNSLRATVNPSAPRCMWSSALNSLNLSFAGLEQVPKGLPAKLRVLDLSCNRLNRAPQPDELPEVDNLTLDGNPFLVPGTALPHEGSMNSGVVPACARSTLSVGVSGTLVLLQGARGFA
Afficher plus
Homologous gene and protein info.
SpeciesGene IDGene SymbolNomNuméro d'identification fiscale Other Gene IDSources
Chimp462118CD14CD14 molecule9598VGNC:3938Inparanoid, OMA, EggNOG
Macaque697482CD14CD14 molecule9544Inparanoid, OMA, EggNOG
Mouse12475Cd14CD14 antigen10090MGI:88318Inparanoid, OMA, EggNOG
Rat60350Cd14CD14 molecule10116RGD:620588Inparanoid, OMA, EggNOG
Horse100630219CD14CD14 molecule9796VGNC:16245Inparanoid, OMA, EggNOG
Cow281048CD14CD14 molecule9913VGNC:27003Inparanoid, OMA, EggNOG
Pig100037938CD14CD14 molecule9823Inparanoid, OMA, EggNOG
Opossum100026364CD14CD14 molecule13616Inparanoid, EggNOG
Anole lizard103278612LOC103278612toll-like receptor 228377OMA, EggNOG

Associated Recombinant Proteins

NomSpecification and purityExpression systemProtein labelDisponibilitéVoir les détails

Associated Antibodies

NomSpecificationsSpecies reactivityApplicationDisponibilitéVoir les détails

Associated Approved Drugs

    Associated Active Ligands

      Associated Diseases

      NomDirect Associated TargetsDisease TypeMondoid

      Bibliography

      🔙[Back to Target (Human)]
      We use cookies to ensure the website functions properly and, where permitted, to improve your experience. You can manage your preferences at any time in Settings. Learn more in our Cookie Policy.

      Shall we send you a message when we have discounts available?

      Remind me later

      Thank you! Please check your email inbox to confirm.

      Oops! Notifications are disabled.

      Privacy Policy Terms of Use Cookie Policy Terms and Conditions of Sale Sales Policy
      Products are supplied to verified businesses, institutions, and qualified professionals for research and development use only. Not for use in humans, animals, diagnosis, or therapy.
      Copyright © 2023–present Aladdin Scientific Corp. All rights reserved.