Basculer la navigation 
Rechercher
224,000+ produits de recherche · Triple ISO certified · COA & SDS disponible pour chaque produit · Expédition le jour même sur les articles en stock
| Description | CX3C chemokine receptor 1 |
|---|
Gene and Protein Information
| Gene ID | 1524 |
|---|---|
| Uniprot Accession IDs | P49238 A0N0N6 B2R5Z4 J3KP17 C-X3-C CKR-1 |
| Ensembl ID | ENSP00000351059 |
| Symbole | CMKBRL1 GPR13 V28 CCRL1 GPR13 CMKDR1 GPRV28 CMKBRL1 |
| Family | Belongs to the G-protein coupled receptor 1 family. |
| Sequence | MDQFPESVTENFEYDDLAEACYIGDIVVFGTVFLSIFYSVIFAIGLVGNLLVVFALTNSKKPKSVTDIYLLNLALSDLLFVATLPFWTHYLINEKGLHNAMCKFTTAFFFIGFFGSIFFITVISIDRYLAIVLAANSMNNRTVQHGVTISLGVWAAAILVAAPQFMFTKQKENECLGDYPEVLQEIWPVLRNVETNFLGFLLPLLIMSYCYFRIIQTLFSCKNHKKAKAIKLILLVVIVFFLFWTPYNVMIFLETLKLYDFFPSCDMRKDLRLALSVTETVAFSHCCLNPLIYAFAGEKFRRYLYHLYGKCLAVLCGRSVHVDFSSSESQRSRHGSVLSSNFTYHTSDGDALLLL Afficher plus |
Homologous gene and protein info.
| Species | Gene ID | Gene Symbol | Nom | Numéro d'identification fiscale | Other Gene ID | Sources |
|---|---|---|---|---|---|---|
| Chimp | 460281 | CX3CR1 | C-X3-C motif chemokine receptor 1 | 9598 | VGNC:8831 | Inparanoid, OMA, EggNOG |
| Macaque | 693926 | CX3CR1 | C-X3-C motif chemokine receptor 1 | 9544 | Inparanoid, OMA, EggNOG | |
| Mouse | 13051 | Cx3cr1 | chemokine (C-X3-C motif) receptor 1 | 10090 | MGI:1333815 | Inparanoid, OMA, EggNOG |
| Rat | 171056 | Cx3cr1 | C-X3-C motif chemokine receptor 1 | 10116 | RGD:620137 | Inparanoid, OMA, EggNOG |
| Dog | 485599 | CX3CR1 | C-X3-C motif chemokine receptor 1 | 9615 | VGNC:39746 | Inparanoid, OMA, EggNOG |
| Horse | 100068350 | CX3CR1 | C-X3-C motif chemokine receptor 1 | 9796 | VGNC:16980 | Inparanoid, OMA, EggNOG |
| Cow | 100124525 | CX3CR1 | C-X3-C motif chemokine receptor 1 | 9913 | VGNC:27845 | Inparanoid, OMA, EggNOG |
| Pig | 100622126 | CX3CR1 | C-X3-C motif chemokine receptor 1 | 9823 | OMA, EggNOG | |
| Opossum | 100028655 | CX3CR1 | C-X3-C motif chemokine receptor 1 | 13616 | Inparanoid, OMA, EggNOG | |
| Platypus | CX3CR1 | C-X3-C motif chemokine receptor 1 [Source:HGNC Symbol;Acc:HGNC:2558] | 9258 | OMA, EggNOG | ||
| Anole lizard | 100559882 | LOC100559882 | CX3C chemokine receptor 1 | 28377 | OMA, EggNOG |
Protein Classes
DTO Classes
protein / G-protein coupled receptor / Class A rhodopsin like / Chemokine receptor / C-X3-C chemokine receptor / CX3C chemokine receptor 1
protein / G-protein coupled receptor / Class A rhodopsin like / Chemokine receptor / C-X3-C chemokine receptor / CX3C chemokine receptor 1
Associated Recombinant Proteins
| Nom | Specification and purity | Expression system | Protein label | Disponibilité | Voir les détails |
|---|
Associated Antibodies
| Nom | Specifications | Species reactivity | Application | Disponibilité | Voir les détails |
|---|
Associated Approved Drugs
Associated Active Ligands
Associated Diseases
| Nom | Direct Associated Targets | Disease Type | Mondoid |
|---|
Bibliography
Remind me later
Products are supplied to verified businesses, institutions, and qualified professionals for research and development use only. Not for use in humans, animals, diagnosis, or therapy.
Copyright © 2023–present Aladdin Scientific Corp. All rights reserved.