🌎 Ship to: United States
Basculer la navigation
Cart
Rechercher
Expédition le jour même pour tous les articles en stock.
Recherche Avancée
Commande rapide SDS / CoA Structure En vrac et personnalisé
Menu
Compte
Paramètres
྾
224,000+ produits de recherche · Triple ISO certified · COA & SDS disponible pour chaque produit · Expédition le jour même sur les articles en stock

DGAT2

DescriptionDiacylglycerol O-acyltransferase 2

Gene and Protein Information

Gene ID84649
Uniprot Accession IDs Q96PD7 A6ND76 Q5U810 Q68CL3 Q68DJ0 Q8NDB7 Q96BS0 Q9BYE5
Ensembl ID ENSP00000228027
Symbole ARAT HMFN1045 GS1999FULL
FamilyBelongs to the diacylglycerol acyltransferase family.
Sequence
MKTLIAAYSGVLRGERQAEADRSQRSHGGPALSREGSGRWGTGSSILSALQDLFSVTWLNRSKVEKQLQVISVLQWVLSFLVLGVACSAILMYIFCTDCWLIAVLYFTWLVFDWNTPKKGGRRSQWVRNWAVWRYFRDYFPIQLVKTHNLLTTRNYIFGYHPHGIMGLGAFCNFSTEATEVSKKFPGIRPYLATLAGNFRMPVLREYLMSGGICPVSRDTIDYLLSKNGSGNAIIIVVGGAAESLSSMPGKNAVTLRNRKGFVKLALRHGADLVPIYSFGENEVYKQVIFEEGSWGRWVQKKFQKYIGFAPCIFHGRGLFSSDTWGLVPYSKPITTVVGEPITIPKLEHPTQQDIDLYHTMYMEALVKLFDKHKTKFGLPETEVLEVN
Afficher plus
Homologous gene and protein info.
SpeciesGene IDGene SymbolNomNuméro d'identification fiscale Other Gene IDSources
Chimp466714DGAT2diacylglycerol O-acyltransferase 29598VGNC:3134OMA, EggNOG
Macaque696549DGAT2diacylglycerol O-acyltransferase 29544OMA, EggNOG
Mouse67800Dgat2diacylglycerol O-acyltransferase 210090MGI:1915050Inparanoid, OMA, EggNOG
Rat252900Dgat2diacylglycerol O-acyltransferase 210116RGD:620329Inparanoid, OMA, EggNOG
Dog485185DGAT2diacylglycerol O-acyltransferase 29615VGNC:39913Inparanoid, OMA, EggNOG
HorseDGAT2diacylglycerol O-acyltransferase 2 [Source:HGNC Symbol;Acc:HGNC:16940]9796OMA, EggNOG
Cow404129DGAT2diacylglycerol O-acyltransferase 29913VGNC:28021Inparanoid, OMA, EggNOG
Opossum100011089DGAT2diacylglycerol O-acyltransferase 213616Inparanoid, OMA, EggNOG
Anole lizard100552736dgat2diacylglycerol O-acyltransferase 228377Inparanoid, OMA, EggNOG
Xenopus395003dgat2diacylglycerol O-acyltransferase 28364XB-GENE-1017054Inparanoid, OMA, EggNOG
Zebrafish565316dgat2diacylglycerol O-acyltransferase 27955ZDB-GENE-050913-15Inparanoid, OMA, EggNOG
S.cerevisiae854419DGA1diacylglycerol O-acyltransferase4932S000005771OMA, EggNOG

Protein Classes

PANTHER Classes
protein    /    transferase    /    acyltransferase    /    Diacylglycerol O-acyltransferase 2
DTO Classes
protein    /    Enzyme    /    Transferase    /    Acyltransferase    /    Diacylglycerol O-acyltransferase 2

Associated Recombinant Proteins

NomSpecification and purityExpression systemProtein labelDisponibilitéVoir les détails

Associated Antibodies

NomSpecificationsSpecies reactivityApplicationDisponibilitéVoir les détails

Associated Approved Drugs

    Associated Active Ligands

      Associated Diseases

      NomDirect Associated TargetsDisease TypeMondoid

      Bibliography

      🔙[Back to Target (Human)]
      We use cookies to ensure the website functions properly and, where permitted, to improve your experience. You can manage your preferences at any time in Settings. Learn more in our Cookie Policy.

      Shall we send you a message when we have discounts available?

      Remind me later

      Thank you! Please check your email inbox to confirm.

      Oops! Notifications are disabled.

      Privacy Policy Terms of Use Cookie Policy Terms and Conditions of Sale Sales Policy
      Products are supplied to verified businesses, institutions, and qualified professionals for research and development use only. Not for use in humans, animals, diagnosis, or therapy.
      Copyright © 2023–present Aladdin Scientific Corp. All rights reserved.