🌎 Ship to: United States
Basculer la navigation
Cart
Rechercher
Expédition le jour même pour tous les articles en stock.
Recherche Avancée
Commande rapide SDS / CoA Structure En vrac et personnalisé
Menu
Compte
Paramètres
྾
224,000+ produits de recherche · Triple ISO certified · COA & SDS disponible pour chaque produit · Expédition le jour même sur les articles en stock

HSD11B1

DescriptionCorticosteroid 11-beta-dehydrogenase isozyme 1

Gene and Protein Information

Gene ID3290
Uniprot Accession IDs P28845 B2R9Z1 D3DT89
Ensembl ID ENSP00000355995
Symbole HSD11 HSD11L SDR26C1 HDL 11-DH HSD11 HSD11B HSD11L CORTRD2 SDR26C1 11-beta-HSD1
FamilyBelongs to the short-chain dehydrogenases/reductases (SDR) family.
Sequence
MAFMKKYLLPILGLFMAYYYYSANEEFRPEMLQGKKVIVTGASKGIGREMAYHLAKMGAHVVVTARSKETLQKVVSHCLELGAASAHYIAGTMEDMTFAEQFVAQAGKLMGGLDMLILNHITNTSLNLFHDDIHHVRKSMEVNFLSYVVLTVAALPMLKQSNGSIVVVSSLAGKVAYPMVAAYSASKFALDGFFSSIRKEYSVSRVNVSITLCVLGLIDTETAMKAVSGIVHMQAAPKEECALEIIKGGALRQEEVYYDSSLWTTLLIRNPCRKILEFLYSTSYNMDRFINK
Homologous gene and protein info.
SpeciesGene IDGene SymbolNomNuméro d'identification fiscale Other Gene IDSources
Chimp457698HSD11B1hydroxysteroid 11-beta dehydrogenase 19598VGNC:11453OMA, EggNOG
Mouse15483Hsd11b1hydroxysteroid 11-beta dehydrogenase 110090MGI:103562Inparanoid, OMA, EggNOG
Rat25116Hsd11b1hydroxysteroid 11-beta dehydrogenase 110116RGD:2834Inparanoid, OMA
Dog449023HSD11B1hydroxysteroid 11-beta dehydrogenase 19615VGNC:41797Inparanoid, OMA, EggNOG
Horse100056429HSD11B1hydroxysteroid 11-beta dehydrogenase 19796VGNC:18880Inparanoid, OMA, EggNOG
Cow282589HSD11B1hydroxysteroid 11-beta dehydrogenase 19913VGNC:29965Inparanoid, OMA, EggNOG
Pig397480HSD11B1hydroxysteroid 11-beta dehydrogenase 19823Inparanoid, OMA, EggNOG
Platypus100079059HSD11B1hydroxysteroid 11-beta dehydrogenase 19258Inparanoid, OMA, EggNOG
Anole lizard100555338hsd11b1hydroxysteroid 11-beta dehydrogenase 128377Inparanoid, OMA, EggNOG
Xenopus100489345hsd11b1hydroxysteroid (11-beta) dehydrogenase 18364XB-GENE-960491Inparanoid, OMA

Associated Recombinant Proteins

NomSpecification and purityExpression systemProtein labelDisponibilitéVoir les détails

Associated Antibodies

NomSpecificationsSpecies reactivityApplicationDisponibilitéVoir les détails

Associated Approved Drugs

    Associated Active Ligands

      Associated Diseases

      NomDirect Associated TargetsDisease TypeMondoid

      Bibliography

      🔙[Back to Target (Human)]
      We use cookies to ensure the website functions properly and, where permitted, to improve your experience. You can manage your preferences at any time in Settings. Learn more in our Cookie Policy.

      Shall we send you a message when we have discounts available?

      Remind me later

      Thank you! Please check your email inbox to confirm.

      Oops! Notifications are disabled.

      Privacy Policy Terms of Use Cookie Policy Terms and Conditions of Sale Sales Policy
      Products are supplied to verified businesses, institutions, and qualified professionals for research and development use only. Not for use in humans, animals, diagnosis, or therapy.
      Copyright © 2023–present Aladdin Scientific Corp. All rights reserved.