🌎 Ship to: United States
Basculer la navigation
Cart
Rechercher
Expédition le jour même pour tous les articles en stock.
Recherche Avancée
Commande rapide SDS / CoA Structure En vrac et personnalisé
Menu
Compte
Paramètres
྾
224,000+ produits de recherche · Triple ISO certified · COA & SDS disponible pour chaque produit · Expédition le jour même sur les articles en stock

CYCS

DescriptionCytochrome c

Gene and Protein Information

Gene ID54205
Uniprot Accession IDs P99999 A4D166 B2R4I1 P00001 Q6NUR2 Q6NX69 Q96BV4
Ensembl ID ENSP00000307786
Symbole CYC CYC HCS THC4
FamilyBelongs to the cytochrome c family.
Sequence
MGDVEKGKKIFIMKCSQCHTVEKGGKHKTGPNLHGLFGRKTGQAPGYSYTAANKNKGIIWGEDTLMEYLENPKKYIPGTKMIFVGIKKKEERADLIAYLKKATNE
Homologous gene and protein info.
SpeciesGene IDGene SymbolNomNuméro d'identification fiscale Other Gene IDSources
Chimp744779CYCScytochrome c, somatic9598VGNC:14767Inparanoid, OMA, EggNOG
Mouse672195Gm10053predicted gene 1005310090MGI:3704493OMA, EggNOG
Rat25309Cycscytochrome c, somatic10116RGD:2451OMA, EggNOG
Dog475258CYCScytochrome c, somatic9615VGNC:50288Inparanoid, OMA, EggNOG
Horse100053958CYCScytochrome c, somatic9796VGNC:50468Inparanoid, OMA, EggNOG
Pig100170131CYCScytochrome c, somatic9823OMA, EggNOG
Opossum100010620LOC100010620cytochrome c13616Inparanoid, OMA, EggNOG
Platypus100077443LOC100077443cytochrome c9258Inparanoid, OMA, EggNOG
Chicken420624CYCScytochrome c, somatic9031CGNC:8375Inparanoid, OMA
Anole lizard100560655LOC100560655cytochrome c28377OMA, EggNOG
Xenopus394490cycscytochrome c, somatic8364XB-GENE-971588Inparanoid, OMA
Xenopus493538cyctcytochrome c, testis8364XB-GENE-5931974OMA, EggNOG
Zebrafish415158cycsbcytochrome c, somatic b7955ZDB-GENE-040625-38Inparanoid, OMA, EggNOG
C. elegans177243cyc-2.1Cytochrome c 2.16239OMA, EggNOG
Fruitfly34996Cyt-c-pCytochrome c proximal7227FBgn0284248Inparanoid, EggNOG
S.cerevisiae856672CYC7cytochrome c isoform 24932S000000765Inparanoid, OMA, EggNOG

Associated Recombinant Proteins

NomSpecification and purityExpression systemProtein labelDisponibilitéVoir les détails

Associated Antibodies

NomSpecificationsSpecies reactivityApplicationDisponibilitéVoir les détails

Associated Approved Drugs

    Associated Active Ligands

      Associated Diseases

      NomDirect Associated TargetsDisease TypeMondoid

      Bibliography

      🔙[Back to Target (Human)]
      We use cookies to ensure the website functions properly and, where permitted, to improve your experience. You can manage your preferences at any time in Settings. Learn more in our Cookie Policy.

      Shall we send you a message when we have discounts available?

      Remind me later

      Thank you! Please check your email inbox to confirm.

      Oops! Notifications are disabled.

      Privacy Policy Terms of Use Cookie Policy Terms and Conditions of Sale Sales Policy
      Products are supplied to verified businesses, institutions, and qualified professionals for research and development use only. Not for use in humans, animals, diagnosis, or therapy.
      Copyright © 2023–present Aladdin Scientific Corp. All rights reserved.