Basculer la navigation 
Rechercher
340,000+ produits de recherche · Triple ISO certified · COA & SDS disponible pour chaque produit · Expédition le jour même sur les articles en stock
| Description | Cyclin-dependent kinase 17 |
|---|
Gene and Protein Information
| Gene ID | 5128 |
|---|---|
| Uniprot Accession IDs | Q00537 A8K1U6 B2RCQ2 Q8NEB8 |
| Ensembl ID | ENSP00000261211 |
| Symbole | PCTAIRE2 PCTK2 PCTK2 PCTAIRE2 |
| Family | Belongs to the protein kinase superfamily. CMGC Ser/Thr protein kinase family. CDC2/CDKX subfamily. |
| Sequence | MKKFKRRLSLTLRGSQTIDESLSELAEQMTIEENSSKDNEPIVKNGRPPTSHSMHSFLHQYTGSFKKPPLRRPHSVIGGSLGSFMAMPRNGSRLDIVHENLKMGSDGESDQASGTSSDEVQSPTGVCLRNRIHRRISMEDLNKRLSLPADIRIPDGYLEKLQINSPPFDQPMSRRSRRASLSEIGFGKMETYIKLEKLGEGTYATVYKGRSKLTENLVALKEIRLEHEEGAPCTAIREVSLLKDLKHANIVTLHDIVHTDKSLTLVFEYLDKDLKQYMDDCGNIMSMHNVKLFLYQILRGLAYCHRRKVLHRDLKPQNLLINEKGELKLADFGLARAKSVPTKTYSNEVVTLWYRPPDVLLGSSEYSTQIDMWGVGCIFFEMASGRPLFPGSTVEDELHLIFRLLGTPSQETWPGISSNEEFKNYNFPKYKPQPLINHAPRLDSEGIELITKFLQYESKKRVSAEEAMKHVYFRSLGPRIHALPESVSIFSLKEIQLQKDPGFRNSSYPETGHGKNRRQSMLF Afficher plus |
Homologous gene and protein info.
| Species | Gene ID | Gene Symbol | Nom | Numéro d'identification fiscale | Other Gene ID | Sources |
|---|---|---|---|---|---|---|
| Chimp | 452146 | CDK17 | cyclin dependent kinase 17 | 9598 | VGNC:8363 | OMA, EggNOG |
| Macaque | 717183 | CDK17 | cyclin dependent kinase 17 | 9544 | Inparanoid, OMA, EggNOG | |
| Mouse | 237459 | Cdk17 | cyclin-dependent kinase 17 | 10090 | MGI:97517 | Inparanoid, OMA, EggNOG |
| Rat | 314743 | Cdk17 | cyclin-dependent kinase 17 | 10116 | RGD:1565593 | Inparanoid, OMA, EggNOG |
| Horse | 100065667 | CDK17 | cyclin dependent kinase 17 | 9796 | VGNC:16343 | Inparanoid, OMA, EggNOG |
| Cow | 539655 | CDK17 | cyclin dependent kinase 17 | 9913 | VGNC:27120 | Inparanoid, OMA, EggNOG |
| Pig | 100622337 | CDK17 | cyclin dependent kinase 17 | 9823 | Inparanoid, OMA, EggNOG | |
| Opossum | 100012745 | CDK17 | cyclin dependent kinase 17 | 13616 | Inparanoid, OMA, EggNOG | |
| Platypus | CDK17 | cyclin dependent kinase 17 [Source:HGNC Symbol;Acc:HGNC:8750] | 9258 | OMA, EggNOG | ||
| Chicken | 417920 | CDK17 | cyclin dependent kinase 17 | 9031 | CGNC:8707 | Inparanoid, OMA, EggNOG |
| Anole lizard | 100558014 | cdk17 | cyclin dependent kinase 17 | 28377 | Inparanoid, OMA, EggNOG | |
| Xenopus | 100101773 | cdk17 | cyclin-dependent kinase 17 | 8364 | XB-GENE-920552 | Inparanoid, OMA, EggNOG |
| Zebrafish | 798487 | cdk17 | cyclin-dependent kinase 17 | 7955 | ZDB-GENE-041210-15 | OMA, EggNOG |
Associated Recombinant Proteins
| Nom | Specification and purity | Expression system | Protein label | Disponibilité | Voir les détails |
|---|
Associated Antibodies
| Nom | Spécifications | Species reactivity | Application | Disponibilité | Voir les détails |
|---|
Associated Approved Drugs
Associated Active Ligands
Associated Diseases
| Nom | Direct Associated Targets | Disease Type | Mondoid |
|---|
Bibliography
Me rappeler plus tard
Products are supplied to verified businesses, institutions, and qualified professionals for research and development use only. Not for use in humans, animals, diagnosis, or therapy.
Copyright © 2023–present Aladdin Scientific Corporation. All rights reserved.