🌎 Ship to: United States
Basculer la navigation
Cart
Rechercher
Expédition le jour même pour tous les articles en stock.
Recherche Avancée
Commande rapide SDS / CoA Structure En vrac et personnalisé
Menu
Compte
Paramètres
྾
224,000+ produits de recherche · Triple ISO certified · COA & SDS disponible pour chaque produit · Expédition le jour même sur les articles en stock

CRY1

DescriptionCryptochrome-1

Gene and Protein Information

Gene ID1407
Uniprot Accession IDs Q16526
Ensembl ID ENSP00000008527
Symbole PHLL1 DSPD PHLL1
FamilyBelongs to the DNA photolyase class-1 family.
Sequence
MGVNAVHWFRKGLRLHDNPALKECIQGADTIRCVYILDPWFAGSSNVGINRWRFLLQCLEDLDANLRKLNSRLFVIRGQPADVFPRLFKEWNITKLSIEYDSEPFGKERDAAIKKLATEAGVEVIVRISHTLYDLDKIIELNGGQPPLTYKRFQTLISKMEPLEIPVETITSEVIEKCTTPLSDDHDEKYGVPSLEELGFDTDGLSSAVWPGGETEALTRLERHLERKAWVANFERPRMNANSLLASPTGLSPYLRFGCLSCRLFYFKLTDLYKKVKKNSSPPLSLYGQLLWREFFYTAATNNPRFDKMEGNPICVQIPWDKNPEALAKWAEGRTGFPWIDAIMTQLRQEGWIHHLARHAVACFLTRGDLWISWEEGMKVFEELLLDADWSINAGSWMWLSCSSFFQQFFHCYCPVGFGRRTDPNGDYIRRYLPVLRGFPAKYIYDPWNAPEGIQKVAKCLIGVNYPKPMVNHAEASRLNIERMKQIYQQLSRYRGLGLLASVPSNPNGNGGFMGYSAENIPGCSSSGSCSQGSGILHYAHGDSQQTHLLKQGRSSMGTGLSGGKRPSQEEDTQSIGPKVQRQSTN
Afficher plus
Homologous gene and protein info.
SpeciesGene IDGene SymbolNomNuméro d'identification fiscale Other Gene IDSources
Chimp452205CRY1cryptochrome circadian regulator 19598VGNC:5348OMA, EggNOG
Macaque703752CRY1cryptochrome circadian regulator 19544Inparanoid, OMA, EggNOG
Mouse12952Cry1cryptochrome 1 (photolyase-like)10090MGI:1270841Inparanoid, OMA, EggNOG
Rat299691Cry1cryptochrome circadian regulator 110116RGD:735083Inparanoid, OMA, EggNOG
Dog474528CRY1cryptochrome circadian regulator 19615VGNC:39633Inparanoid, OMA, EggNOG
Horse100034165CRY1cryptochrome circadian regulator 19796VGNC:16880Inparanoid, OMA, EggNOG
Cow535947CRY1cryptochrome circadian regulator 19913VGNC:27730Inparanoid, OMA, EggNOG
Pig100520380CRY1cryptochrome circadian regulator 19823Inparanoid, OMA, EggNOG
Opossum100619810CRY1cryptochrome circadian regulator 113616Inparanoid, OMA, EggNOG
PlatypusCRY1cryptochrome circadian regulator 1 [Source:HGNC Symbol;Acc:HGNC:2384]9258OMA, EggNOG
Chicken374093CRY1cryptochrome circadian clock 19031CGNC:9591Inparanoid, OMA
Anole lizard100553773cry1cryptochrome circadian regulator 128377Inparanoid, OMA
Xenopus550065cry1cryptochrome circadian regulator 18364XB-GENE-946007Inparanoid, OMA

Protein Classes

PANTHER Classes
protein    /    nucleic acid binding    /    DNA photolyase    /    Cryptochrome-1
protein    /    nucleic acid binding    /    lyase    /    Cryptochrome-1
DTO Classes
protein    /    Enzyme    /    Lyase    /    DNA photolyase    /    Cryptochrome-1

Associated Recombinant Proteins

NomSpecification and purityExpression systemProtein labelDisponibilitéVoir les détails

Associated Antibodies

NomSpecificationsSpecies reactivityApplicationDisponibilitéVoir les détails

Associated Approved Drugs

    Associated Active Ligands

      Associated Diseases

      NomDirect Associated TargetsDisease TypeMondoid

      Bibliography

      🔙[Back to Target (Human)]
      We use cookies to ensure the website functions properly and, where permitted, to improve your experience. You can manage your preferences at any time in Settings. Learn more in our Cookie Policy.

      Shall we send you a message when we have discounts available?

      Remind me later

      Thank you! Please check your email inbox to confirm.

      Oops! Notifications are disabled.

      Privacy Policy Terms of Use Cookie Policy Terms and Conditions of Sale Sales Policy
      Products are supplied to verified businesses, institutions, and qualified professionals for research and development use only. Not for use in humans, animals, diagnosis, or therapy.
      Copyright © 2023–present Aladdin Scientific Corp. All rights reserved.