Basculer la navigation 
Rechercher
224,000+ produits de recherche · Triple ISO certified · COA & SDS disponible pour chaque produit · Expédition le jour même sur les articles en stock
| Description | CD63 antigen |
|---|
Gene and Protein Information
| Gene ID | 967 |
|---|---|
| Uniprot Accession IDs | P08962 F8VZE2 Q5TZP3 Q8N6Z9 Q9UCG6 |
| Ensembl ID | ENSP00000447730 |
| Symbole | MLA1 TSPAN30 MLA1 ME491 LAMP-3 OMA81H TSPAN30 |
| Family | Belongs to the tetraspanin (TM4SF) family. |
| Sequence | MAVEGGMKCVKFLLYVLLLAFCACAVGLIAVGVGAQLVLSQTIIQGATPGSLLPVVIIAVGVFLFLVAFVGCCGACKENYCLMITFAIFLSLIMLVEVAAAIAGYVFRDKVMSEFNNNFRQQMENYPKNNHTASILDRMQADFKCCGAANYTDWEKIPSMSKNRVPDSCCINVTVGCGINFNEKAIHKEGCVEKIGGWLRKNVLVVAAAALGIAFVEVLGIVFACCLVKSIRSGYEVM |
Homologous gene and protein info.
| Species | Gene ID | Gene Symbol | Nom | Numéro d'identification fiscale | Other Gene ID | Sources |
|---|---|---|---|---|---|---|
| Chimp | 451969 | CD63 | CD63 molecule | 9598 | VGNC:12886 | OMA, EggNOG |
| Macaque | 709828 | CD63 | CD63 molecule | 9544 | Inparanoid, OMA, EggNOG | |
| Mouse | 12512 | Cd63 | CD63 antigen | 10090 | MGI:99529 | Inparanoid, OMA, EggNOG |
| Rat | 29186 | Cd63 | Cd63 molecule | 10116 | RGD:62080 | Inparanoid, OMA, EggNOG |
| Dog | 474391 | CD63 | CD63 molecule | 9615 | VGNC:38967 | Inparanoid, OMA, EggNOG |
| Horse | 100051450 | CD63 | CD63 molecule | 9796 | VGNC:16275 | Inparanoid, OMA, EggNOG |
| Cow | 404156 | CD63 | CD63 molecule | 9913 | Inparanoid, OMA, EggNOG | |
| Anole lizard | 100561059 | cd63 | CD63 molecule | 28377 | Inparanoid, OMA, EggNOG | |
| Xenopus | 549167 | cd63 | CD63 molecule | 8364 | XB-GENE-1015227 | Inparanoid, OMA, EggNOG |
| Zebrafish | 321461 | cd63 | CD63 molecule | 7955 | ZDB-GENE-030131-180 | Inparanoid, OMA, EggNOG |
| C. elegans | 192062 | tsp-7 | Tetraspanin | 6239 | Inparanoid, EggNOG |
Associated Recombinant Proteins
| Nom | Specification and purity | Expression system | Protein label | Disponibilité | Voir les détails |
|---|
Associated Antibodies
| Nom | Specifications | Species reactivity | Application | Disponibilité | Voir les détails |
|---|
Associated Approved Drugs
Associated Active Ligands
Associated Diseases
| Nom | Direct Associated Targets | Disease Type | Mondoid |
|---|
Bibliography
Remind me later
Products are supplied to verified businesses, institutions, and qualified professionals for research and development use only. Not for use in humans, animals, diagnosis, or therapy.
Copyright © 2023–present Aladdin Scientific Corp. All rights reserved.