CD34

DescriptionHematopoietic progenitor cell antigen CD34

Gene and Protein Information

Gene ID947
Uniprot Accession IDs P28906 A8K664 Q15970 Q15971 Q5JTA3 Q5JTA4 Q9UJB1
Ensembl ID ENSP00000310036
FamilyBelongs to the CD34 family.
Sequence
MLVRRGARAGPRMPRGWTALCLLSLLPSGFMSLDNNGTATPELPTQGTFSNVSTNVSYQETTTPSTLGSTSLHPVSQHGNEATTNITETTVKFTSTSVITSVYGNTNSSVQSQTSVISTVFTTPANVSTPETTLKPSLSPGNVSDLSTTSTSLATSPTKPYTSSSPILSDIKAEIKCSGIREVKLTQGICLEQNKTSSCAEFKKDRGEGLARVLCGEEQADADAGAQVCSLLLAQSEVRPQCLLLVLANRTEISSKLQLMKKHQSDLKKLGILDFTEQDVASHQSYSQKTLIALVTSGALLAVLGITGYFLMNRRSWSPTGERLGEDPYYTENGGGQGYSSGPGTSPEAQGKASVNRGAQENGTGQATSRNGHSARQHVVADTEL
Afficher plus
Homologous gene and protein info.
SpeciesGene IDGene SymbolNomNuméro d'identification fiscale Other Gene IDSources
Chimp457692CD34CD34 molecule9598VGNC:5010OMA, EggNOG
Macaque713858CD34CD34 molecule9544Inparanoid, OMA, EggNOG
Mouse12490Cd34CD34 antigen10090MGI:88329Inparanoid, OMA, EggNOG
Rat305081Cd34CD34 molecule10116RGD:1306863Inparanoid, OMA, EggNOG
Dog415130CD34CD34 molecule9615VGNC:38950Inparanoid, OMA, EggNOG
Horse100051718CD34CD34 molecule9796VGNC:16260Inparanoid, OMA, EggNOG
Cow281051CD34CD34 molecule9913VGNC:27025Inparanoid, OMA, EggNOG
Opossum100021117CD34CD34 molecule13616Inparanoid, EggNOG
Chicken419856CD34CD34 molecule9031CGNC:799Inparanoid, OMA, EggNOG
Anole lizard100553261cd34CD34 molecule28377Inparanoid, OMA, EggNOG
Xenopus779603cd34CD34 molecule8364XB-GENE-6457891OMA, EggNOG

Associated Recombinant Proteins

NomSpecification and purityExpression systemProtein labelDisponibilitéVoir les détails

Associated Antibodies

NomSpecificationsSpecies reactivityApplicationDisponibilitéVoir les détails

Associated Approved Drugs

    Associated Active Ligands

      Associated Diseases

      NomDirect Associated TargetsDisease TypeMondoid

      Bibliography

      Shall we send you a message when we have discounts available?

      Remind me later

      Thank you! Please check your email inbox to confirm.

      Oops! Notifications are disabled.