Basculer la navigation 
Rechercher
340,000+ produits de recherche · Triple ISO certified · COA & SDS disponible pour chaque produit · Expédition le jour même sur les articles en stock
| Description | CCAAT/enhancer-binding protein epsilon |
|---|
Gene and Protein Information
| Gene ID | 1053 |
|---|---|
| Uniprot Accession IDs | Q15744 Q15745 Q8IYI2 Q99803 C/EBP epsilon |
| Ensembl ID | ENSP00000206513 |
| Symbole | CRP1 C/EBP-epsilon |
| Family | Belongs to the bZIP family. C/EBP subfamily. |
| Sequence | MSHGTYYECEPRGGQQPLEFSGGRAGPGELGDMCEHEASIDLSAYIESGEEQLLSDLFAVKPAPEARGLKGPGTPAFPHYLPPDPRPFAYPPHTFGPDRKALGPGIYSSPGSYDPRAVAVKEEPRGPEGSRAASRGSYNPLQYQVAHCGQTAMHLPPTLAAPGQPLRVLKAPLATAAPPCSPLLKAPSPAGPLHKGKKAVNKDSLEYRLRRERNNIAVRKSRDKAKRRILETQQKVLEYMAENERLRSRVEQLTQELDTLRNLFRQIPEAANLIKGVGGCS |
Homologous gene and protein info.
| Species | Gene ID | Gene Symbol | Nom | Numéro d'identification fiscale | Other Gene ID | Sources |
|---|---|---|---|---|---|---|
| Chimp | 743538 | CEBPE | CCAAT enhancer binding protein epsilon | 9598 | VGNC:8195 | OMA, EggNOG |
| Macaque | 713442 | CEBPE | CCAAT/enhancer binding protein epsilon | 9544 | Inparanoid, OMA, EggNOG | |
| Mouse | 110794 | Cebpe | CCAAT/enhancer binding protein (C/EBP), epsilon | 10090 | MGI:103572 | Inparanoid, OMA |
| Rat | 25410 | Cebpe | CCAAT/enhancer binding protein epsilon | 10116 | RGD:2329 | Inparanoid, OMA |
| Horse | 100052512 | CEBPE | CCAAT enhancer binding protein epsilon | 9796 | VGNC:16381 | Inparanoid, OMA |
| Cow | 534346 | CEBPE | CCAAT enhancer binding protein epsilon | 9913 | VGNC:27162 | Inparanoid, OMA |
| Anole lizard | 100554198 | cebpe | CCAAT/enhancer binding protein epsilon | 28377 | Inparanoid, OMA | |
| Xenopus | CEBPE | CCAAT/enhancer binding protein epsilon [Source:HGNC Symbol;Acc:HGNC:1836] | 8364 | OMA, EggNOG |
Protein Classes
PANTHER Classes
protein / transcription factor / basic leucine zipper transcription factor / CCAAT/enhancer-binding protein epsilon
protein / transcription factor / nucleic acid binding / CCAAT/enhancer-binding protein epsilon
protein / transcription factor / basic leucine zipper transcription factor / CCAAT/enhancer-binding protein epsilon
protein / transcription factor / nucleic acid binding / CCAAT/enhancer-binding protein epsilon
DTO Classes
protein / Transcription factor / Basic leucine zipper transcription factor / CCAAT/enhancer-binding protein epsilon
protein / Transcription factor / Basic leucine zipper transcription factor / CCAAT/enhancer-binding protein epsilon
Associated Recombinant Proteins
| Nom | Specification and purity | Expression system | Protein label | Disponibilité | Voir les détails |
|---|
Associated Antibodies
| Nom | Spécifications | Species reactivity | Application | Disponibilité | Voir les détails |
|---|
Associated Approved Drugs
Associated Active Ligands
Associated Diseases
| Nom | Direct Associated Targets | Disease Type | Mondoid |
|---|
Bibliography
Me rappeler plus tard
Products are supplied to verified businesses, institutions, and qualified professionals for research and development use only. Not for use in humans, animals, diagnosis, or therapy.
Copyright © 2023–present Aladdin Scientific Corporation. All rights reserved.