Basculer la navigation 
Rechercher
340,000+ produits de recherche · Triple ISO certified · COA & SDS disponible pour chaque produit · Expédition le jour même sur les articles en stock
| Description | Sphingolipid delta(4)-desaturase DES1 |
|---|
Gene and Protein Information
| Gene ID | 8560 |
|---|---|
| Uniprot Accession IDs | O15121 |
| Ensembl ID | ENSP00000316476 |
| Symbole | DES1 MLD MLD DEGS DES1 Des-1 FADS7 MIG15 DEGS-1 |
| Family | Belongs to the fatty acid desaturase type 1 family. DEGS subfamily. |
| Sequence | MGSRVSREDFEWVYTDQPHADRRREILAKYPEIKSLMKPDPNLIWIIIMMVLTQLGAFYIVKDLDWKWVIFGAYAFGSCINHSMTLAIHEIAHNAAFGNCKAMWNRWFGMFANLPIGIPYSISFKRYHMDHHRYLGADGVDVDIPTDFEGWFFCTAFRKFIWVILQPLFYAFRPLFINPKPITYLEVINTVAQVTFDILIYYFLGIKSLVYMLAASLLGLGLHPISGHFIAEHYMFLKGHETYSYYGPLNLLTFNVGYHNEHHDFPNIPGKSLPLVRKIAAEYYDNLPHYNSWIKVLYDFVMDDTISPYSRMKRHQKGEMVLE Afficher plus |
Homologous gene and protein info.
| Species | Gene ID | Gene Symbol | Nom | Numéro d'identification fiscale | Other Gene ID | Sources |
|---|---|---|---|---|---|---|
| Chimp | 457770 | DEGS1 | delta 4-desaturase, sphingolipid 1 | 9598 | VGNC:8250 | OMA, EggNOG |
| Macaque | 702128 | DEGS1 | delta 4-desaturase, sphingolipid 1 | 9544 | Inparanoid, OMA, EggNOG | |
| Mouse | 13244 | Degs1 | delta(4)-desaturase, sphingolipid 1 | 10090 | MGI:1097711 | Inparanoid, OMA, EggNOG |
| Rat | 58970 | Degs1 | delta(4)-desaturase, sphingolipid 1 | 10116 | RGD:70917 | Inparanoid, OMA, EggNOG |
| Dog | 490395 | DEGS1 | delta 4-desaturase, sphingolipid 1 | 9615 | VGNC:49678 | Inparanoid, OMA, EggNOG |
| Horse | 100055442 | DEGS1 | delta 4-desaturase, sphingolipid 1 | 9796 | VGNC:17117 | Inparanoid, OMA, EggNOG |
| Cow | 507290 | DEGS1 | delta 4-desaturase, sphingolipid 1 | 9913 | VGNC:27990 | Inparanoid, OMA, EggNOG |
| Pig | 100135677 | DEGS1 | delta 4-desaturase, sphingolipid 1 | 9823 | Inparanoid, OMA, EggNOG | |
| Opossum | 100018776 | DEGS1 | delta 4-desaturase, sphingolipid 1 | 13616 | Inparanoid, OMA, EggNOG | |
| Platypus | 100081682 | DEGS1 | delta 4-desaturase, sphingolipid 1 | 9258 | Inparanoid, OMA, EggNOG | |
| Chicken | 421327 | DEGS1 | delta 4-desaturase, sphingolipid 1 | 9031 | CGNC:51468 | Inparanoid, OMA |
| Anole lizard | 100551856 | degs1 | delta 4-desaturase, sphingolipid 1 | 28377 | Inparanoid, OMA | |
| Xenopus | 493214 | degs1 | delta(4)-desaturase, sphingolipid 1 | 8364 | XB-GENE-946874 | Inparanoid, OMA |
| Zebrafish | 327075 | degs1 | delta(4)-desaturase, sphingolipid 1 | 7955 | ZDB-GENE-030131-5283 | Inparanoid, OMA |
| C. elegans | 173327 | ttm-5 | Putative sphingolipid delta(4)-desaturase/C4-monooxygenase | 6239 | Inparanoid, OMA |
Associated Recombinant Proteins
| Nom | Specification and purity | Expression system | Protein label | Disponibilité | Voir les détails |
|---|
Associated Antibodies
| Nom | Spécifications | Species reactivity | Application | Disponibilité | Voir les détails |
|---|
Associated Approved Drugs
Associated Active Ligands
Associated Diseases
| Nom | Direct Associated Targets | Disease Type | Mondoid |
|---|
Bibliography
Me rappeler plus tard
Products are supplied to verified businesses, institutions, and qualified professionals for research and development use only. Not for use in humans, animals, diagnosis, or therapy.
Copyright © 2023–present Aladdin Scientific Corporation. All rights reserved.