Basculer la navigation 
Rechercher
340,000+ produits de recherche · Triple ISO certified · COA & SDS disponible pour chaque produit · Expédition le jour même sur les articles en stock
| Description | Dual adapter for phosphotyrosine and 3-phosphotyrosine and 3-phosphoinositide |
|---|
Gene and Protein Information
| Gene ID | 27071 |
|---|---|
| Uniprot Accession IDs | Q9UN19 Q8TCK5 Q9UHF2 hDAPP1 |
| Ensembl ID | ENSP00000423602 |
| Symbole | BAM32 BAM32 |
| Sequence | MGRAELLEGKMSTQDPSDLWSRSDGEAELLQDLGWYHGNLTRHAAEALLLSNGCDGSYLLRDSNETTGLYSLSVRAKDSVKHFHVEYTGYSFKFGFNEFSSLKDFVKHFANQPLIGSETGTLMVLKHPYPRKVEEPSIYESVRVHTAMQTGRTEDDLVPTAPSLGTKEGYLTKQGGLVKTWKTRWFTLHRNELKYFKDQMSPEPIRILDLTECSAVQFDYSQERVNCFCLVFPFRTFYLCAKTGVEADEWIKILRWKLSQIRKQLNQGEGTIRSRSFIFK |
Homologous gene and protein info.
| Species | Gene ID | Gene Symbol | Nom | Numéro d'identification fiscale | Other Gene ID | Sources |
|---|---|---|---|---|---|---|
| Chimp | 461398 | DAPP1 | dual adaptor of phosphotyrosine and 3-phosphoinositides 1 | 9598 | VGNC:10853 | OMA, EggNOG |
| Macaque | 709038 | DAPP1 | dual adaptor of phosphotyrosine and 3-phosphoinositides 1 | 9544 | Inparanoid, OMA, EggNOG | |
| Mouse | 26377 | Dapp1 | dual adaptor for phosphotyrosine and 3-phosphoinositides 1 | 10090 | MGI:1347063 | Inparanoid, OMA, EggNOG |
| Rat | 362046 | Dapp1 | dual adaptor of phosphotyrosine and 3-phosphoinositides 1 | 10116 | RGD:1310189 | Inparanoid, OMA, EggNOG |
| Dog | 478491 | DAPP1 | dual adaptor of phosphotyrosine and 3-phosphoinositides 1 | 9615 | VGNC:39773 | Inparanoid, OMA, EggNOG |
| Horse | 100053857 | DAPP1 | dual adaptor of phosphotyrosine and 3-phosphoinositides 1 | 9796 | VGNC:17010 | Inparanoid, OMA, EggNOG |
| Cow | 533156 | DAPP1 | dual adaptor of phosphotyrosine and 3-phosphoinositides 1 | 9913 | VGNC:27880 | Inparanoid, OMA, EggNOG |
| Opossum | 100015430 | DAPP1 | dual adaptor of phosphotyrosine and 3-phosphoinositides 1 | 13616 | Inparanoid, OMA, EggNOG | |
| Platypus | DAPP1 | dual adaptor of phosphotyrosine and 3-phosphoinositides 1 [Source:HGNC Symbol;Acc:HGNC:16500] | 9258 | OMA, EggNOG | ||
| Anole lizard | 100556013 | dapp1 | dual adaptor of phosphotyrosine and 3-phosphoinositides 1 | 28377 | Inparanoid, OMA, EggNOG | |
| Xenopus | 548440 | dapp1 | dual adaptor of phosphotyrosine and 3-phosphoinositides | 8364 | XB-GENE-482064 | Inparanoid, OMA, EggNOG |
| Zebrafish | 550386 | dapp1 | dual adaptor of phosphotyrosine and 3-phosphoinositides | 7955 | ZDB-GENE-050417-180 | Inparanoid, OMA, EggNOG |
Associated Recombinant Proteins
| Nom | Specification and purity | Expression system | Protein label | Disponibilité | Voir les détails |
|---|
Associated Antibodies
| Nom | Spécifications | Species reactivity | Application | Disponibilité | Voir les détails |
|---|
Associated Approved Drugs
Associated Active Ligands
Associated Diseases
| Nom | Direct Associated Targets | Disease Type | Mondoid |
|---|
Bibliography
Me rappeler plus tard
Products are supplied to verified businesses, institutions, and qualified professionals for research and development use only. Not for use in humans, animals, diagnosis, or therapy.
Copyright © 2023–present Aladdin Scientific Corporation. All rights reserved.