🌎 Ship to: United States
Basculer la navigation
Cart
Rechercher
Expédition le jour même pour tous les articles en stock.
Recherche Avancée
Commande rapide SDS / CoA Structure En vrac et personnalisé
Menu
Compte
Paramètres
྾
224,000+ produits de recherche · Triple ISO certified · COA & SDS disponible pour chaque produit · Expédition le jour même sur les articles en stock

RAD52

DescriptionDNA repair protein RAD52 homolog

Gene and Protein Information

Gene ID5893
Uniprot Accession IDs P43351 Q13205 Q9Y5T7 Q9Y5T8 Q9Y5T9
Ensembl ID ENSP00000351284
FamilyBelongs to the RAD52 family.
Sequence
MSGTEEAILGGRDSHPAAGGGSVLCFGQCQYTAEEYQAIQKALRQRLGPEYISSRMAGGGQKVCYIEGHRVINLANEMFGYNGWAHSITQQNVDFVDLNNGKFYVGVCAFVRVQLKDGSYHEDVGYGVSEGLKSKALSLEKARKEAVTDGLKRALRSFGNALGNCILDKDYLRSLNKLPRQLPLEVDLTKAKRQDLEPSVEEARYNSCRPNMALGHPQLQQVTSPSRPSHAVIPADQDCSSRSLSSSAVESEATHQRKLRQKQLQQQFRERMEKQQVRVSTPSAEKSEAAPPAPPVTHSTPVTVSEPLLEKDFLAGVTQELIKTLEDNSEKWAVTPDAGDGVVKPSSRADPAQTSDTLALNNQMVTQNRTPHSVCHQKPQAKSGSWDLQTYSADQRTTGNWESHRKSQDMKKRKYDPS
Afficher plus
Homologous gene and protein info.
SpeciesGene IDGene SymbolNomNuméro d'identification fiscale Other Gene IDSources
Chimp466911RAD52RAD52 homolog, DNA repair protein9598VGNC:5563OMA, EggNOG
Macaque100426645RAD52RAD52 homolog (S. cerevisiae)9544OMA, EggNOG
Mouse19365Rad52RAD52 homolog, DNA repair protein10090MGI:101949Inparanoid, OMA, EggNOG
Rat297561Rad52RAD52 homolog, DNA repair protein10116RGD:1304975Inparanoid, OMA, EggNOG
Dog477729RAD52RAD52 homolog, DNA repair protein9615VGNC:45321Inparanoid, OMA, EggNOG
Horse100050254RAD52RAD52 homolog, DNA repair protein9796VGNC:22150Inparanoid, OMA, EggNOG
Cow512897RAD52RAD52 homolog, DNA repair protein9913VGNC:33688Inparanoid, OMA, EggNOG
Pig100141308RAD52RAD52 homolog, DNA repair protein9823OMA, EggNOG
Opossum100020944RAD52RAD52 homolog, DNA repair protein13616Inparanoid, EggNOG
Xenopus100036666rad52RAD52 homolog, DNA repair protein8364XB-GENE-991154Inparanoid, EggNOG
Zebrafish554171rad52RAD52 homolog, DNA repair protein7955ZDB-GENE-050731-10Inparanoid, EggNOG

Protein Classes

PANTHER Classes
protein    /    nucleic acid binding    /    DNA binding protein    /    DNA repair protein RAD52 homolog
DTO Classes
protein    /    Nucleic acid binding    /    DNA binding protein    /    DNA repair protein RAD52 homolog

Associated Recombinant Proteins

NomSpecification and purityExpression systemProtein labelDisponibilitéVoir les détails

Associated Antibodies

NomSpecificationsSpecies reactivityApplicationDisponibilitéVoir les détails

Associated Approved Drugs

    Associated Active Ligands

      Associated Diseases

      NomDirect Associated TargetsDisease TypeMondoid

      Bibliography

      🔙[Back to Target (Human)]
      We use cookies to ensure the website functions properly and, where permitted, to improve your experience. You can manage your preferences at any time in Settings. Learn more in our Cookie Policy.

      Shall we send you a message when we have discounts available?

      Remind me later

      Thank you! Please check your email inbox to confirm.

      Oops! Notifications are disabled.

      Privacy Policy Terms of Use Cookie Policy Terms and Conditions of Sale Sales Policy
      Products are supplied to verified businesses, institutions, and qualified professionals for research and development use only. Not for use in humans, animals, diagnosis, or therapy.
      Copyright © 2023–present Aladdin Scientific Corp. All rights reserved.