🌎 Ship to: United States
Basculer la navigation
Cart
Rechercher
Expédition le jour même pour tous les articles en stock.
Recherche Avancée
Commande rapide SDS / CoA Structure En vrac et personnalisé
Menu
Compte
Paramètres
྾
224,000+ produits de recherche · Triple ISO certified · COA & SDS disponible pour chaque produit · Expédition le jour même sur les articles en stock

RAP2C

DescriptionRas-related protein Rap-2c

Gene and Protein Information

Gene ID57826
Uniprot Accession IDs Q9Y3L5 B3KWD6 Q5H9H9 Q9BTS0
Ensembl ID ENSP00000340274
FamilyBelongs to the small GTPase superfamily. Ras family.
Sequence
MREYKVVVLGSGGVGKSALTVQFVTGTFIEKYDPTIEDFYRKEIEVDSSPSVLEILDTAGTEQFASMRDLYIKNGQGFILVYSLVNQQSFQDIKPMRDQIVRVKRYEKVPLILVGNKVDLEPEREVMSSEGRALAQEWGCPFMETSAKSKSMVDELFAEIVRQMNYSSLPEKQDQCCTTCVVQ
Homologous gene and protein info.
SpeciesGene IDGene SymbolNomNuméro d'identification fiscale Other Gene IDSources
Mouse72065Rap2cRAP2C, member of RAS oncogene family10090MGI:1919315Inparanoid, OMA
Rat302495Rap2cRAP2C, member of RAS oncogene family10116RGD:1588562Inparanoid, OMA
Dog481054RAP2CRAP2C, member of RAS oncogene family9615VGNC:45345Inparanoid, OMA
Horse100054364RAP2CRAP2C, member of RAS oncogene family9796VGNC:22178Inparanoid, OMA
Cow515181RAP2CRAP2C, member of RAS oncogene family9913VGNC:33721Inparanoid, OMA
Opossum100022678RAP2CRAP2C, member of RAS oncogene family13616Inparanoid, OMA
Platypus100084311RAP2CRAP2C, member of RAS oncogene family9258Inparanoid, OMA
Chicken422232RAP2CRAP2C, member of RAS oncogene family9031CGNC:51667Inparanoid, OMA
Xenopus549652rap2cRAP2C, member of RAS oncogene family8364XB-GENE-489027Inparanoid, OMA
Zebrafish474323rap2cRAP2C, member of RAS oncogene family7955ZDB-GENE-041024-1Inparanoid, OMA

Protein Classes

PANTHER Classes
protein    /    enzyme modulator    /    small GTPase    /    Ras-related protein Rap-2c
DTO Classes
protein    /    Enzyme modulator    /    G-protein    /    Small GTPase    /    Ras-related protein Rap-2c

Associated Recombinant Proteins

NomSpecification and purityExpression systemProtein labelDisponibilitéVoir les détails

Associated Antibodies

NomSpecificationsSpecies reactivityApplicationDisponibilitéVoir les détails

Associated Approved Drugs

    Associated Active Ligands

      Associated Diseases

      NomDirect Associated TargetsDisease TypeMondoid

      Bibliography

      🔙[Back to Target (Human)]
      We use cookies to ensure the website functions properly and, where permitted, to improve your experience. You can manage your preferences at any time in Settings. Learn more in our Cookie Policy.

      Shall we send you a message when we have discounts available?

      Remind me later

      Thank you! Please check your email inbox to confirm.

      Oops! Notifications are disabled.

      Privacy Policy Terms of Use Cookie Policy Terms and Conditions of Sale Sales Policy
      Products are supplied to verified businesses, institutions, and qualified professionals for research and development use only. Not for use in humans, animals, diagnosis, or therapy.
      Copyright © 2023–present Aladdin Scientific Corp. All rights reserved.