🌎 Ship to: United States
Basculer la navigation
Cart
Rechercher
Expédition le jour même pour tous les articles en stock.
Recherche Avancée
Commande rapide SDS / CoA Structure En vrac et personnalisé
Menu
Compte
Paramètres
྾
224,000+ produits de recherche · Triple ISO certified · COA & SDS disponible pour chaque produit · Expédition le jour même sur les articles en stock

PSMB9

DescriptionProteasome subunit beta type-9

Gene and Protein Information

Gene ID5698
Uniprot Accession IDs P28065 B0V0T1 Q16523 Q5JNW4
Ensembl ID ENSP00000363993
Symbole LMP2 PSMB6i RING12 LMP2 PRAAS3 PSMB6i RING12 beta1i
FamilyBelongs to the peptidase T1B family.
Sequence
MLRAGAPTGDLPRAGEVHTGTTIMAVEFDGGVVMGSDSRVSAGEAVVNRVFDKLSPLHERIYCALSGSAADAQAVADMAAYQLELHGIELEEPPLVLAAANVVRNISYKYREDLSAHLMVAGWDQREGGQVYGTLGGMLTRQPFAIGGSGSTFIYGYVDAAYKPGMSPEECRRFTTDAIALAMSRDGSSGGVIYLVTITAAGVDHRVILGNELPKFYDE
Homologous gene and protein info.
SpeciesGene IDGene SymbolNomNuméro d'identification fiscale Other Gene IDSources
Macaque716980PSMB9proteasome subunit beta 99544Inparanoid, OMA
Mouse16912Psmb9proteasome (prosome, macropain) subunit, beta type 9 (large multifunctional peptidase 2)10090MGI:1346526Inparanoid, OMA
Rat24967Psmb9proteasome subunit beta 910116RGD:3427Inparanoid, OMA
Dog474867PSMB9proteasome subunit beta 99615VGNC:45100Inparanoid, OMA
Horse100060885PSMB9proteasome subunit beta 99796VGNC:21948Inparanoid, OMA
Cow510593PSMB9proteasome subunit beta 99913VGNC:33453Inparanoid, OMA
Opossum100026764PSMB9proteasome subunit beta 913616Inparanoid, OMA
Xenopus445259psmb9proteasome subunit beta 98364XB-GENE-481018Inparanoid, OMA
Zebrafish30665psmb9aproteasome subunit beta 9a7955ZDB-GENE-990415-140Inparanoid, OMA
C. elegans176978pbs-1Proteasome subunit beta type6239Inparanoid, OMA

Associated Recombinant Proteins

NomSpecification and purityExpression systemProtein labelDisponibilitéVoir les détails

Associated Antibodies

NomSpecificationsSpecies reactivityApplicationDisponibilitéVoir les détails

Associated Approved Drugs

    Associated Active Ligands

      Associated Diseases

      NomDirect Associated TargetsDisease TypeMondoid

      Bibliography

      🔙[Back to Target (Human)]
      We use cookies to ensure the website functions properly and, where permitted, to improve your experience. You can manage your preferences at any time in Settings. Learn more in our Cookie Policy.

      Shall we send you a message when we have discounts available?

      Remind me later

      Thank you! Please check your email inbox to confirm.

      Oops! Notifications are disabled.

      Privacy Policy Terms of Use Cookie Policy Terms and Conditions of Sale Sales Policy
      Products are supplied to verified businesses, institutions, and qualified professionals for research and development use only. Not for use in humans, animals, diagnosis, or therapy.
      Copyright © 2023–present Aladdin Scientific Corp. All rights reserved.