Basculer la navigation 
Rechercher
224,000+ produits de recherche · Triple ISO certified · COA & SDS disponible pour chaque produit · Expédition le jour même sur les articles en stock
| Description | Proteasome subunit beta type-2 |
|---|
Gene and Protein Information
| Gene ID | 5690 |
|---|---|
| Uniprot Accession IDs | P49721 D3DPS0 P31145 Q9BWZ9 |
| Ensembl ID | ENSP00000362334 |
| Symbole | HC7-I |
| Family | Belongs to the peptidase T1B family. |
| Sequence | MEYLIGIQGPDYVLVASDRVAASNIVQMKDDHDKMFKMSEKILLLCVGEAGDTVQFAEYIQKNVQLYKMRNGYELSPTAAANFTRRNLADCLRSRTPYHVNLLLAGYDEHEGPALYYMDYLAALAKAPFAAHGYGAFLTLSILDRYYTPTISRERAVELLRKCLEELQKRFILNLPTFSVRIIDKNGIHDLDNISFPKQGS |
Homologous gene and protein info.
| Species | Gene ID | Gene Symbol | Nom | Numéro d'identification fiscale | Other Gene ID | Sources |
|---|---|---|---|---|---|---|
| Chimp | 469277 | PSMB2 | proteasome subunit beta 2 | 9598 | VGNC:11806 | Inparanoid, OMA, EggNOG |
| Macaque | 712193 | PSMB2 | proteasome subunit beta 2 | 9544 | Inparanoid, OMA, EggNOG | |
| Mouse | 26445 | Psmb2 | proteasome (prosome, macropain) subunit, beta type 2 | 10090 | MGI:1347045 | Inparanoid, OMA, EggNOG |
| Rat | 29675 | Psmb2 | proteasome subunit beta 2 | 10116 | RGD:61874 | Inparanoid, OMA, EggNOG |
| Dog | 475338 | PSMB2 | proteasome subunit beta 2 | 9615 | VGNC:45095 | Inparanoid, OMA, EggNOG |
| Horse | 100055325 | PSMB2 | proteasome subunit beta 2 | 9796 | VGNC:21941 | Inparanoid, OMA, EggNOG |
| Cow | 516919 | PSMB2 | proteasome subunit beta 2 | 9913 | VGNC:33446 | Inparanoid, OMA, EggNOG |
| Platypus | 100077529 | PSMB2 | proteasome subunit beta 2 | 9258 | Inparanoid, OMA, EggNOG | |
| Chicken | 419630 | PSMB2 | proteasome subunit beta 2 | 9031 | CGNC:66347 | Inparanoid, OMA |
| Anole lizard | 100566839 | psmb2 | proteasome subunit beta 2 | 28377 | Inparanoid, OMA, EggNOG | |
| Xenopus | 496467 | psmb2 | proteasome subunit beta 2 | 8364 | XB-GENE-946101 | Inparanoid, OMA, EggNOG |
| Zebrafish | 436882 | psmb2 | proteasome subunit beta 2 | 7955 | ZDB-GENE-040718-353 | Inparanoid, OMA, EggNOG |
| C. elegans | 171975 | pbs-4 | Proteasome subunit beta type-2 | 6239 | Inparanoid, OMA | |
| S.cerevisiae | 856731 | PRE1 | proteasome core particle subunit beta 4 | 4932 | S000000814 | Inparanoid, OMA, EggNOG |
Associated Recombinant Proteins
| Nom | Specification and purity | Expression system | Protein label | Disponibilité | Voir les détails |
|---|
Associated Antibodies
| Nom | Specifications | Species reactivity | Application | Disponibilité | Voir les détails |
|---|
Associated Approved Drugs
Associated Active Ligands
Associated Diseases
| Nom | Direct Associated Targets | Disease Type | Mondoid |
|---|
Bibliography
Remind me later
Products are supplied to verified businesses, institutions, and qualified professionals for research and development use only. Not for use in humans, animals, diagnosis, or therapy.
Copyright © 2023–present Aladdin Scientific Corp. All rights reserved.