🌎 Ship to: United States
Basculer la navigation
Cart
Rechercher
Expédition le jour même pour tous les articles en stock.
Recherche Avancée
Commande rapide SDS / CoA Structure En vrac et personnalisé
Menu
Compte
Paramètres
྾
224,000+ produits de recherche · Triple ISO certified · COA & SDS disponible pour chaque produit · Expédition le jour même sur les articles en stock

PSMB10

DescriptionProteasome subunit beta type-10

Gene and Protein Information

Gene ID5699
Uniprot Accession IDs P40306 B2R5J4 Q5U098
Ensembl ID ENSP00000351314
Symbole LMP10 MECL1 LMP10 MECL1 beta2i
FamilyBelongs to the peptidase T1B family.
Sequence
MLKPALEPRGGFSFENCQRNASLERVLPGLKVPHARKTGTTIAGLVFQDGVILGADTRATNDSVVADKSCEKIHFIAPKIYCCGAGVAADAEMTTRMVASKMELHALSTGREPRVATVTRILRQTLFRYQGHVGASLIVGGVDLTGPQLYGVHPHGSYSRLPFTALGSGQDAALAVLEDRFQPNMTLEAAQGLLVEAVTAGILGDLGSGGNVDACVITKTGAKLLRTLSSPTEPVKRSGRYHFVPGTTAVLTQTVKPLTLELVEETVQAMEVE
Homologous gene and protein info.
SpeciesGene IDGene SymbolNomNuméro d'identification fiscale Other Gene IDSources
Chimp743176PSMB10proteasome subunit beta 109598VGNC:13783OMA, EggNOG
Mouse19171Psmb10proteasome (prosome, macropain) subunit, beta type 1010090MGI:1096380Inparanoid, OMA, EggNOG
Rat291983Psmb10proteasome subunit beta 1010116RGD:1307428Inparanoid, OMA, EggNOG
Dog489749PSMB10proteasome subunit beta 109615Inparanoid, OMA, EggNOG
Horse100066381PSMB10proteasome subunit beta 109796Inparanoid, OMA, EggNOG
Cow282328PSMB10proteasome subunit beta 109913Inparanoid, OMA, EggNOG
Opossum100021740PSMB10proteasome subunit beta 1013616Inparanoid, EggNOG

Associated Recombinant Proteins

NomSpecification and purityExpression systemProtein labelDisponibilitéVoir les détails

Associated Antibodies

NomSpecificationsSpecies reactivityApplicationDisponibilitéVoir les détails

Associated Approved Drugs

    Associated Active Ligands

      Associated Diseases

      NomDirect Associated TargetsDisease TypeMondoid

      Bibliography

      🔙[Back to Target (Human)]
      We use cookies to ensure the website functions properly and, where permitted, to improve your experience. You can manage your preferences at any time in Settings. Learn more in our Cookie Policy.

      Shall we send you a message when we have discounts available?

      Remind me later

      Thank you! Please check your email inbox to confirm.

      Oops! Notifications are disabled.

      Privacy Policy Terms of Use Cookie Policy Terms and Conditions of Sale Sales Policy
      Products are supplied to verified businesses, institutions, and qualified professionals for research and development use only. Not for use in humans, animals, diagnosis, or therapy.
      Copyright © 2023–present Aladdin Scientific Corp. All rights reserved.