🌎 Ship to: United States
Basculer la navigation
Cart
Rechercher
Expédition le jour même pour tous les articles en stock.
Recherche Avancée
Commande rapide SDS / CoA Structure En vrac et personnalisé
Menu
Compte
Paramètres
྾
224,000+ produits de recherche · Triple ISO certified · COA & SDS disponible pour chaque produit · Expédition le jour même sur les articles en stock

SRD5A1

Description3-oxo-5-alpha-steroid 4-dehydrogenase 1

Gene and Protein Information

Gene ID6715
Uniprot Accession IDs P18405 B2R7Q1 Q9UHY4 Q9UP36 Q9UP37
Ensembl ID ENSP00000274192
Symbole S5AR 1
FamilyBelongs to the steroid 5-alpha reductase family.
Sequence
MATATGVAEERLLAALAYLQCAVGCAVFARNRQTNSVYGRHALPSHRLRVPARAAWVVQELPSLALPLYQYASESAPRLRSAPNCILLAMFLVHYGHRCLIYPFLMRGGKPMPLLACTMAIMFCTCNGYLQSRYLSHCAVYADDWVTDPRFLIGFGLWLTGMLINIHSDHILRNLRKPGDTGYKIPRGGLFEYVTAANYFGEIMEWCGYALASWSVQGAAFAFFTFCFLSGRAKEHHEWYLRKFEEYPKFRKIIIPFLF
Homologous gene and protein info.
SpeciesGene IDGene SymbolNomNuméro d'identification fiscale Other Gene IDSources
Chimp743740SRD5A1steroid 5 alpha-reductase 19598VGNC:7155OMA, EggNOG
Macaque695103SRD5A1steroid 5 alpha-reductase 19544Inparanoid, OMA, EggNOG
Mouse78925Srd5a1steroid 5 alpha-reductase 110090MGI:98400Inparanoid, OMA, EggNOG
Rat24950Srd5a1steroid 5 alpha-reductase 110116RGD:3757Inparanoid, OMA, EggNOG
Dog403716SRD5A1steroid 5 alpha-reductase 19615VGNC:46793Inparanoid, OMA, EggNOG
Horse100071450SRD5A1steroid 5 alpha-reductase 19796VGNC:23573Inparanoid, OMA, EggNOG
Cow614612SRD5A1steroid 5 alpha-reductase 19913VGNC:35271Inparanoid, OMA, EggNOG
Pig100518046SRD5A1steroid 5 alpha-reductase 19823OMA, EggNOG
Opossum100018123SRD5A1steroid 5 alpha-reductase 113616Inparanoid, OMA, EggNOG
Chicken770453SRD5A1steroid-5-alpha-reductase, alpha polypeptide 1 (3-oxo-5 alpha-steroid delta 4-dehydrogenase alpha 1)9031CGNC:56034OMA, EggNOG
Xenopus448586srd5a1steroid-5-alpha-reductase, alpha polypeptide 1 (3-oxo-5 alpha-steroid delta 4-dehydrogenase alpha 1)8364XB-GENE-1000046Inparanoid, OMA, EggNOG
Zebrafish767715srd5a1steroid-5-alpha-reductase, alpha polypeptide 1 (3-oxo-5 alpha-steroid delta 4-dehydrogenase alpha 1)7955ZDB-GENE-060929-938Inparanoid, EggNOG
C. elegans184699F19H6.4hypothetical protein6239OMA, EggNOG

Protein Classes

PANTHER Classes
protein    /    oxidoreductase    /    dehydrogenase    /    3-oxo-5-alpha-steroid 4-dehydrogenase 1
DTO Classes
protein    /    Enzyme    /    Oxidoreductase    /    Dehydrogenase    /    3-oxo-5-alpha-steroid 4-dehydrogenase 1

Associated Recombinant Proteins

NomSpecification and purityExpression systemProtein labelDisponibilitéVoir les détails

Associated Antibodies

NomSpecificationsSpecies reactivityApplicationDisponibilitéVoir les détails

Associated Approved Drugs

    Associated Active Ligands

      Associated Diseases

      NomDirect Associated TargetsDisease TypeMondoid

      Bibliography

      🔙[Back to Target (Human)]
      We use cookies to ensure the website functions properly and, where permitted, to improve your experience. You can manage your preferences at any time in Settings. Learn more in our Cookie Policy.

      Shall we send you a message when we have discounts available?

      Remind me later

      Thank you! Please check your email inbox to confirm.

      Oops! Notifications are disabled.

      Privacy Policy Terms of Use Cookie Policy Terms and Conditions of Sale Sales Policy
      Products are supplied to verified businesses, institutions, and qualified professionals for research and development use only. Not for use in humans, animals, diagnosis, or therapy.
      Copyright © 2023–present Aladdin Scientific Corp. All rights reserved.