S100B

DescriptionProtein S100-B

Gene and Protein Information

Gene ID6285
Uniprot Accession IDs P04271 D3DSN6
Ensembl ID ENSP00000291700
Symbole NEF S100 S100-B S100beta
FamilyBelongs to the S-100 family.
Sequence
MSELEKAMVALIDVFHQYSGREGDKHKLKKSELKELINNELSHFLEEIKEQEVVDKVMETLDNDGDGECDFQEFMAFVAMVTTACHEFFEHE
Homologous gene and protein info.
SpeciesGene IDGene SymbolNomNuméro d'identification fiscale Other Gene IDSources
Chimp474141S100BS100 calcium binding protein B9598VGNC:1125OMA, EggNOG
Macaque708117S100BS100 calcium binding protein B9544Inparanoid, OMA, EggNOG
Mouse20203S100bS100 protein, beta polypeptide, neural10090MGI:98217Inparanoid, OMA, EggNOG
Rat25742S100bS100 calcium binding protein B10116RGD:3615Inparanoid, OMA, EggNOG
Dog491615S100BS100 calcium binding protein B9615VGNC:49642Inparanoid, OMA, EggNOG
Horse100054841S100BS100 calcium binding protein B9796VGNC:22656Inparanoid, OMA, EggNOG
Cow525716S100BS100 calcium binding protein B9913VGNC:34248Inparanoid, OMA, EggNOG
Pig100623510S100BS100 calcium binding protein B9823OMA, EggNOG
PlatypusS100BS100 calcium binding protein B [Source:HGNC Symbol;Acc:HGNC:10500]9258OMA, EggNOG
Chicken424038S100BS100 calcium binding protein B9031CGNC:4668Inparanoid, OMA, EggNOG
Zebrafish436825s100bS100 calcium binding protein, beta (neural)7955ZDB-GENE-040718-290Inparanoid, OMA, EggNOG

Protein Classes

PANTHER Classes
protein    /    calcium-binding protein    /    calmodulin    /    Protein S100-B
protein    /    calcium-binding protein    /    signaling molecule    /    Protein S100-B
DTO Classes
protein    /    Calcium-binding protein    /    Intracellular calcium-sensing protein    /    Calmodulin    /    Protein S100-B

Associated Recombinant Proteins

NomSpecification and purityExpression systemProtein labelDisponibilitéVoir les détails

Associated Antibodies

NomSpecificationsSpecies reactivityApplicationDisponibilitéVoir les détails

Associated Approved Drugs

    Associated Active Ligands

      Associated Diseases

      NomDirect Associated TargetsDisease TypeMondoid

      Bibliography

      Shall we send you a message when we have discounts available?

      Remind me later

      Thank you! Please check your email inbox to confirm.

      Oops! Notifications are disabled.