SLC36A1

DescriptionProton-coupled amino acid transporter 1

Gene and Protein Information

Gene ID206358
Uniprot Accession IDs Q7Z2H8 C9JI34 Q1LZ56 Q7Z7C0 Q86YK4 Q96M74 Proton/amino acid transporter 1
Ensembl ID ENSP00000243389
Symbole PAT1 Dct1 PAT1 LYAAT1 TRAMD3
FamilyBelongs to the amino acid/polyamine transporter 2 family.
Sequence
MSTQRLRNEDYHDYSSTDVSPEESPSEGLNNLSSPGSYQRFGQSNSTTWFQTLIHLLKGNIGTGLLGLPLAVKNAGIVMGPISLLIIGIVAVHCMGILVKCAHHFCRRLNKSFVDYGDTVMYGLESSPCSWLRNHAHWGRRVVDFFLIVTQLGFCCVYFVFLADNFKQVIEAANGTTNNCHNNETVILTPTMDSRLYMLSFLPFLVLLVFIRNLRALSIFSLLANITMLVSLVMIYQFIVQRIPDPSHLPLVAPWKTYPLFFGTAIFSFEGIGMVLPLENKMKDPRKFPLILYLGMVIVTILYISLGCLGYLQFGANIQGSITLNLPNCWLYQSVKLLYSIGIFFTYALQFYVPAEIIIPFFVSRAPEHCELVVDLFVRTVLVCLTCILAILIPRLDLVISLVGSVSSSALALIIPPLLEVTTFYSEGMSPLTIFKDALISILGFVGFVVGTYEALYELIQPSNAPIFINSTCAFI
Afficher plus
Homologous gene and protein info.
SpeciesGene IDGene SymbolNomNuméro d'identification fiscale Other Gene IDSources
Chimp471708SLC36A1solute carrier family 36 member 19598VGNC:8644OMA, EggNOG
Macaque713630SLC36A1solute carrier family 36 member 19544Inparanoid, OMA, EggNOG
Mouse215335Slc36a1solute carrier family 36 (proton/amino acid symporter), member 110090MGI:2445299Inparanoid, OMA, EggNOG
Rat155205Slc36a1solute carrier family 36 member 110116RGD:619801Inparanoid, OMA, EggNOG
Dog489173SLC36A1solute carrier family 36 member 19615VGNC:46382Inparanoid, OMA, EggNOG
Horse100071523SLC36A1solute carrier family 36 member 19796VGNC:23180Inparanoid, OMA
Cow518759SLC36A1solute carrier family 36 member 19913VGNC:34838Inparanoid, OMA, EggNOG
Pig100514926SLC36A1solute carrier family 36 member 19823Inparanoid, EggNOG
Anole lizard100553431LOC100553431proton-coupled amino acid transporter 128377OMA, EggNOG
Xenopusslc36a1solute carrier family 36 (proton/amino acid symporter), member 1 [Source:Xenbase;Acc:XB-GENE-976345]8364OMA, EggNOG

Protein Classes

PANTHER Classes
protein    /    transporter    /    amino acid transporter    /    Proton-coupled amino acid transporter 1
DTO Classes
protein    /    Transporter    /    SLC superfamily of solute carriers    /    SLC36 family of proton-coupled amino acid transporters    /    Proton-coupled amino acid transporter 1

Associated Recombinant Proteins

NomSpecification and purityExpression systemProtein labelDisponibilitéVoir les détails

Associated Antibodies

NomSpecificationsSpecies reactivityApplicationDisponibilitéVoir les détails

Associated Approved Drugs

    Associated Active Ligands

      Associated Diseases

      NomDirect Associated TargetsDisease TypeMondoid

      Bibliography

      Shall we send you a message when we have discounts available?

      Remind me later

      Thank you! Please check your email inbox to confirm.

      Oops! Notifications are disabled.