🌎 Ship to: United States
Basculer la navigation
Cart
Rechercher
Expédition le jour même pour tous les articles en stock.
Recherche Avancée
Commande rapide SDS / CoA Structure En vrac et personnalisé
Menu
Compte
Paramètres
྾
224,000+ produits de recherche · Triple ISO certified · COA & SDS disponible pour chaque produit · Expédition le jour même sur les articles en stock

GJC3

DescriptionGap junction gamma-3 protein

Gene and Protein Information

Gene ID349149
Uniprot Accession IDs Q8NFK1 A4D296 Q86XI9
Ensembl ID ENSP00000325775
Symbole GJE1 CX29 GJE1 CX30.2 CX31.3
FamilyBelongs to the connexin family. Gamma-type subfamily.
Sequence
MCGRFLRRLLAEESRRSTPVGRLLLPVLLGFRLVLLAASGPGVYGDEQSEFVCHTQQPGCKAACFDAFHPLSPLRFWVFQVILVAVPSALYMGFTLYHVIWHWELSGKGKEEETLIQGREGNTDVPGAGSLRLLWAYVAQLGARLVLEGAALGLQYHLYGFQMPSSFACRREPCLGSITCNLSRPSEKTIFLKTMFGVSGFCLLFTFLELVLLGLGRWWRTWKHKSSSSKYFLTSESTRRHKKATDSLPVVETKEQFQEAVPGRSLAQEKQRPVGPRDA
Homologous gene and protein info.
SpeciesGene IDGene SymbolNomNuméro d'identification fiscale Other Gene IDSources
Chimp737656GJC3gap junction protein gamma 39598VGNC:14017OMA, EggNOG
Macaque100424576LOC100424576gap junction gamma-3 protein9544OMA, EggNOG
Mouse118446Gjc3gap junction protein, gamma 310090MGI:2153041Inparanoid, OMA, EggNOG
Rat288529Gjc3gap junction protein, gamma 310116RGD:727930Inparanoid, OMA, EggNOG
Dog489850GJC3gap junction protein gamma 39615VGNC:54027Inparanoid, OMA, EggNOG
Horse100068490GJC3gap junction protein gamma 39796VGNC:18361Inparanoid, OMA, EggNOG
Cow539991GJC3gap junction protein gamma 39913VGNC:29384Inparanoid, OMA, EggNOG

Protein Classes

PANTHER Classes
protein    /    cell junction protein    /    gap junction    /    Gap junction gamma-3 protein
DTO Classes
protein    /    Cell-cell junction    /    Gap junction    /    Gap junction gamma-3 protein

Associated Recombinant Proteins

NomSpecification and purityExpression systemProtein labelDisponibilitéVoir les détails

Associated Antibodies

NomSpecificationsSpecies reactivityApplicationDisponibilitéVoir les détails

Associated Approved Drugs

    Associated Active Ligands

      Associated Diseases

      NomDirect Associated TargetsDisease TypeMondoid

      Bibliography

      🔙[Back to Target (Human)]
      We use cookies to ensure the website functions properly and, where permitted, to improve your experience. You can manage your preferences at any time in Settings. Learn more in our Cookie Policy.

      Shall we send you a message when we have discounts available?

      Remind me later

      Thank you! Please check your email inbox to confirm.

      Oops! Notifications are disabled.

      Privacy Policy Terms of Use Cookie Policy Terms and Conditions of Sale Sales Policy
      Products are supplied to verified businesses, institutions, and qualified professionals for research and development use only. Not for use in humans, animals, diagnosis, or therapy.
      Copyright © 2023–present Aladdin Scientific Corp. All rights reserved.