🌎 Ship to: United States
Basculer la navigation
Cart
Rechercher
Expédition le jour même pour tous les articles en stock.
Recherche Avancée
Commande rapide SDS / CoA Structure En vrac et personnalisé
Menu
Compte
Paramètres
྾
224,000+ produits de recherche · Triple ISO certified · COA & SDS disponible pour chaque produit · Expédition le jour même sur les articles en stock

MRPL44

Description39S ribosomal protein L44, mitochondrial

Gene and Protein Information

Gene ID65080
Uniprot Accession IDs Q9H9J2 Q53S16 Q6IA62 Q9H821 L44mt
Ensembl ID ENSP00000258383
Symbole L44MT COXPD16 MRP-L44
FamilyBelongs to the ribonuclease III family. Mitochondrion-specific ribosomal protein mL44 subfamily.
Sequence
MASGLVRLLQQGHRCLLAPVAPKLVPPVRGVKKGFRAAFRFQKELERQRLLRCPPPPVRRSEKPNWDYHAEIQAFGHRLQENFSLDLLKTAFVNSCYIKSEEAKRQQLGIEKEAVLLNLKSNQELSEQGTSFSQTCLTQFLEDEYPDMPTEGIKNLVDFLTGEEVVCHVARNLAVEQLTLSEEFPVPPAVLQQTFFAVIGALLQSSGPERTALFIRDFLITQMTGKELFEMWKIINPMGLLVEELKKRNVSAPESRLTRQSGGTTALPLYFVGLYCDKKLIAEGPGETVLVAEEEAARVALRKLYGFTENRRPWNYSKPKETLRAEKSITAS
Afficher plus
Homologous gene and protein info.
SpeciesGene IDGene SymbolNomNuméro d'identification fiscale Other Gene IDSources
Chimp470663MRPL44mitochondrial ribosomal protein L449598VGNC:2022OMA, EggNOG
Macaque677716MRPL44mitochondrial ribosomal protein L449544Inparanoid, OMA
Mouse69163Mrpl44mitochondrial ribosomal protein L4410090MGI:1916413Inparanoid, OMA, EggNOG
Rat301552Mrpl44mitochondrial ribosomal protein L4410116RGD:1309556Inparanoid, OMA, EggNOG
Dog100855653MRPL44mitochondrial ribosomal protein L449615VGNC:43399Inparanoid, OMA, EggNOG
Horse100056697MRPL44mitochondrial ribosomal protein L449796VGNC:20343Inparanoid, OMA, EggNOG
Cow532389MRPL44mitochondrial ribosomal protein L449913VGNC:31639Inparanoid, OMA, EggNOG
Pig100153145MRPL44mitochondrial ribosomal protein L449823Inparanoid, OMA, EggNOG
Opossum100022395MRPL44mitochondrial ribosomal protein L4413616Inparanoid, OMA, EggNOG
Chicken424795MRPL44mitochondrial ribosomal protein L449031CGNC:2221Inparanoid, OMA, EggNOG
Anole lizard100564313mrpl44mitochondrial ribosomal protein L4428377Inparanoid, OMA
Xenopus496841mrpl44mitochondrial ribosomal protein L448364XB-GENE-1000272Inparanoid, OMA, EggNOG
Zebrafish571210mrpl44mitochondrial ribosomal protein L447955ZDB-GENE-050913-59Inparanoid, OMA, EggNOG
Fruitfly40656mRpL44mitochondrial ribosomal protein L447227FBgn0037330Inparanoid, EggNOG

Protein Classes

PANTHER Classes
protein    /    nucleic acid binding    /    endoribonuclease    /    39S ribosomal protein L44, mitochondrial
protein    /    nucleic acid binding    /    RNA binding protein    /    39S ribosomal protein L44, mitochondrial
protein    /    nucleic acid binding    /    nuclease    /    39S ribosomal protein L44, mitochondrial
DTO Classes
protein    /    Enzyme    /    Nuclease    /    Endoribonuclease    /    39S ribosomal protein L44, mitochondrial

Associated Recombinant Proteins

NomSpecification and purityExpression systemProtein labelDisponibilitéVoir les détails

Associated Antibodies

NomSpecificationsSpecies reactivityApplicationDisponibilitéVoir les détails

Associated Approved Drugs

    Associated Active Ligands

      Associated Diseases

      NomDirect Associated TargetsDisease TypeMondoid

      Bibliography

      🔙[Back to Target (Human)]
      We use cookies to ensure the website functions properly and, where permitted, to improve your experience. You can manage your preferences at any time in Settings. Learn more in our Cookie Policy.

      Shall we send you a message when we have discounts available?

      Remind me later

      Thank you! Please check your email inbox to confirm.

      Oops! Notifications are disabled.

      Privacy Policy Terms of Use Cookie Policy Terms and Conditions of Sale Sales Policy
      Products are supplied to verified businesses, institutions, and qualified professionals for research and development use only. Not for use in humans, animals, diagnosis, or therapy.
      Copyright © 2023–present Aladdin Scientific Corp. All rights reserved.