Basculer la navigation 
Rechercher
224,000+ produits de recherche · Triple ISO certified · COA & SDS disponible pour chaque produit · Expédition le jour même sur les articles en stock
| Description | Sepiapterin reductase |
|---|
Gene and Protein Information
| Gene ID | 6697 |
|---|---|
| Uniprot Accession IDs | P35270 A8K741 D6W5H2 Q53GI9 Q9UBB1 SPR |
| Ensembl ID | ENSP00000234454 |
| Symbole | SDR38C1 |
| Family | Belongs to the sepiapterin reductase family. |
| Sequence | MEGGLGRAVCLLTGASRGFGRTLAPLLASLLSPGSVLVLSARNDEALRQLEAELGAERSGLRVVRVPADLGAEAGLQQLLGALRELPRPKGLQRLLLINNAGSLGDVSKGFVDLSDSTQVNNYWALNLTSMLCLTSSVLKAFPDSPGLNRTVVNISSLCALQPFKGWALYCAGKAARDMLFQVLALEEPNVRVLNYAPGPLDTDMQQLARETSVDPDMRKGLQELKAKGKLVDCKVSAQKLLSLLEKDEFKSGAHVDFYDK |
Homologous gene and protein info.
| Species | Gene ID | Gene Symbol | Nom | Numéro d'identification fiscale | Other Gene ID | Sources |
|---|---|---|---|---|---|---|
| Macaque | 705317 | SPR | sepiapterin reductase | 9544 | Inparanoid, OMA, EggNOG | |
| Mouse | 20751 | Spr | sepiapterin reductase | 10090 | MGI:103078 | Inparanoid, OMA, EggNOG |
| Rat | 29270 | Spr | sepiapterin reductase | 10116 | RGD:3753 | Inparanoid, OMA, EggNOG |
| Dog | 483118 | SPR | sepiapterin reductase | 9615 | VGNC:49109 | Inparanoid, OMA, EggNOG |
| Cow | 533836 | SPR | sepiapterin reductase | 9913 | Inparanoid, OMA, EggNOG | |
| Pig | 100521367 | SPR | sepiapterin reductase | 9823 | OMA, EggNOG | |
| Chicken | 425255 | SPR | sepiapterin reductase (7,8-dihydrobiopterin:NADP+ oxidoreductase) | 9031 | CGNC:32 | Inparanoid, OMA, EggNOG |
| Anole lizard | SPR | sepiapterin reductase [Source:HGNC Symbol;Acc:HGNC:11257] | 28377 | Inparanoid, OMA, EggNOG | ||
| Zebrafish | 554136 | spra | sepiapterin reductase a | 7955 | ZDB-GENE-050522-412 | OMA, EggNOG |
| Zebrafish | 795445 | sprb | sepiapterin reductase b | 7955 | ZDB-GENE-070719-1 | Inparanoid, OMA |
| Fruitfly | 31781 | Sptr | Sepiapterin reductase | 7227 | FBgn0014032 | Inparanoid, EggNOG |
Associated Recombinant Proteins
| Nom | Specification and purity | Expression system | Protein label | Disponibilité | Voir les détails |
|---|
Associated Antibodies
| Nom | Specifications | Species reactivity | Application | Disponibilité | Voir les détails |
|---|
Associated Approved Drugs
Associated Active Ligands
Associated Diseases
| Nom | Direct Associated Targets | Disease Type | Mondoid |
|---|
Bibliography
Remind me later
Products are supplied to verified businesses, institutions, and qualified professionals for research and development use only. Not for use in humans, animals, diagnosis, or therapy.
Copyright © 2023–present Aladdin Scientific Corp. All rights reserved.