🌎 Ship to: United States
Basculer la navigation
Cart
Rechercher
Expédition le jour même pour tous les articles en stock.
Recherche Avancée
Commande rapide SDS / CoA Structure En vrac et personnalisé
Menu
Compte
Paramètres
྾
224,000+ produits de recherche · Triple ISO certified · COA & SDS disponible pour chaque produit · Expédition le jour même sur les articles en stock

STK24

DescriptionSerine/threonine-protein kinase 24

Gene and Protein Information

Gene ID8428
Uniprot Accession IDs Q9Y6E0 O14840 Q5JV92
Ensembl ID ENSP00000365730
Symbole MST3 STK3 MST3 STK3 MST3B STE20 HEL-S-95
FamilyBelongs to the protein kinase superfamily. STE Ser/Thr protein kinase family. STE20 subfamily.
Sequence
MDSRAQLWGLALNKRRATLPHPGGSTNLKADPEELFTKLEKIGKGSFGEVFKGIDNRTQKVVAIKIIDLEEAEDEIEDIQQEITVLSQCDSPYVTKYYGSYLKDTKLWIIMEYLGGGSALDLLEPGPLDETQIATILREILKGLDYLHSEKKIHRDIKAANVLLSEHGEVKLADFGVAGQLTDTQIKRNTFVGTPFWMAPEVIKQSAYDSKADIWSLGITAIELARGEPPHSELHPMKVLFLIPKNNPPTLEGNYSKPLKEFVEACLNKEPSFRPTAKELLKHKFILRNAKKTSYLTELIDRYKRWKAEQSHDDSSSEDSDAETDGQASGGSDSGDWIFTIREKDPKNLENGALQPSDLDRNKMKDIPKRPFSQCLSTIISPLFAELKEKSQACGGNLGSIEELRGAIYLAEEACPGISDTMVAQLVQRLQRYSLSGGGTSSH
Afficher plus
Homologous gene and protein info.
SpeciesGene IDGene SymbolNomNuméro d'identification fiscale Other Gene IDSources
Chimp452633STK24serine/threonine kinase 249598VGNC:5115OMA, EggNOG
Macaque697841STK24serine/threonine kinase 249544Inparanoid, OMA, EggNOG
Mouse223255Stk24serine/threonine kinase 2410090MGI:2385007Inparanoid, OMA, EggNOG
Rat361092Stk24serine/threonine kinase 2410116RGD:1561742Inparanoid, OMA, EggNOG
Dog100688038STK24serine/threonine kinase 249615VGNC:49657Inparanoid, OMA, EggNOG
Horse100050664STK24serine/threonine kinase 249796VGNC:23685Inparanoid, OMA, EggNOG
Cow100101492STK24serine/threonine kinase 249913VGNC:35390Inparanoid, OMA, EggNOG
Pig100154569STK24serine/threonine kinase 249823Inparanoid, OMA, EggNOG
Opossum100026462STK24serine/threonine kinase 2413616Inparanoid, OMA, EggNOG
PlatypusSTK24serine/threonine kinase 24 [Source:HGNC Symbol;Acc:HGNC:11403]9258OMA, EggNOG
Chicken418780STK24serine/threonine kinase 249031CGNC:50850Inparanoid, OMA
Anole lizard100565759stk24serine/threonine kinase 2428377Inparanoid, OMA
Xenopus100170450stk24serine/threonine kinase 248364XB-GENE-987144Inparanoid, OMA

Protein Classes

DTO Classes
protein    /    Kinase    /    Protein kinase    /    STE group    /    STE20 family    /    YSK subfamily    /    Serine/threonine-protein kinase 24

Associated Recombinant Proteins

NomSpecification and purityExpression systemProtein labelDisponibilitéVoir les détails

Associated Antibodies

NomSpecificationsSpecies reactivityApplicationDisponibilitéVoir les détails

Associated Approved Drugs

    Associated Active Ligands

      Associated Diseases

      NomDirect Associated TargetsDisease TypeMondoid

      Bibliography

      🔙[Back to Target (Human)]
      We use cookies to ensure the website functions properly and, where permitted, to improve your experience. You can manage your preferences at any time in Settings. Learn more in our Cookie Policy.

      Shall we send you a message when we have discounts available?

      Remind me later

      Thank you! Please check your email inbox to confirm.

      Oops! Notifications are disabled.

      Privacy Policy Terms of Use Cookie Policy Terms and Conditions of Sale Sales Policy
      Products are supplied to verified businesses, institutions, and qualified professionals for research and development use only. Not for use in humans, animals, diagnosis, or therapy.
      Copyright © 2023–present Aladdin Scientific Corp. All rights reserved.