🌎 Ship to: United States
Basculer la navigation
Cart
Rechercher
Expédition le jour même pour tous les articles en stock.
Recherche Avancée
Commande rapide SDS / CoA Structure En vrac et personnalisé
Menu
Compte
Paramètres
྾
224,000+ produits de recherche · Triple ISO certified · COA & SDS disponible pour chaque produit · Expédition le jour même sur les articles en stock

TXNDC12

DescriptionThioredoxin domain-containing protein 12

Gene and Protein Information

Gene ID51060
Uniprot Accession IDs O95881 B3KQS0 Q5T1T4 Q96H50
Ensembl ID ENSP00000360688
Symbole TLP19 AG1 AGR1 ERP16 ERP18 ERP19 TLP19 hAG-1 PDIA16 hTLP19
Sequence
METRPRLGATCLLGFSFLLLVISSDGHNGLGKGFGDHIHWRTLEDGKKEAAASGLPLMVIIHKSWCGACKALKPKFAESTEISELSHNFVMVNLEDEEEPKDEDFSPDGGYIPRILFLDPSGKVHPEIINENGNPSYKYFYVSAEQVVQGMKEAQERLTGDAFRKKHLEDEL
Homologous gene and protein info.
SpeciesGene IDGene SymbolNomNuméro d'identification fiscale Other Gene IDSources
Chimp100610643TXNDC12thioredoxin domain containing 129598VGNC:9409OMA, EggNOG
Mouse66073Txndc12thioredoxin domain containing 12 (endoplasmic reticulum)10090MGI:1913323Inparanoid, OMA, EggNOG
Rat298370Txndc12thioredoxin domain containing 1210116RGD:1305960Inparanoid, OMA, EggNOG
Dog609843TXNDC12thioredoxin domain containing 129615VGNC:48011Inparanoid, OMA, EggNOG
Horse100062254TXNDC12thioredoxin domain containing 129796VGNC:24677Inparanoid, OMA, EggNOG
Cow506991TXNDC12thioredoxin domain containing 129913VGNC:36535Inparanoid, OMA, EggNOG
Pig100517534TXNDC12thioredoxin domain containing 129823OMA, EggNOG
Opossum103095270TXNDC12thioredoxin domain containing 1213616Inparanoid, OMA, EggNOG
Chicken772208TXNDC12thioredoxin domain containing 129031CGNC:8025Inparanoid, OMA, EggNOG
Anole lizard100562080txndc12thioredoxin domain containing 1228377Inparanoid, OMA, EggNOG
Zebrafish324900txndc12thioredoxin domain containing 12 (endoplasmic reticulum)7955ZDB-GENE-050522-497Inparanoid, OMA, EggNOG

Protein Classes

PANTHER Classes
protein    /    oxidoreductase    /    reductase    /    Thioredoxin domain-containing protein 12
protein    /    oxidoreductase    /    surfactant    /    Thioredoxin domain-containing protein 12
DTO Classes
protein    /    Enzyme    /    Oxidoreductase    /    Reductase    /    Thioredoxin domain-containing protein 12

Associated Recombinant Proteins

NomSpecification and purityExpression systemProtein labelDisponibilitéVoir les détails

Associated Antibodies

NomSpecificationsSpecies reactivityApplicationDisponibilitéVoir les détails

Associated Approved Drugs

    Associated Active Ligands

      Associated Diseases

      NomDirect Associated TargetsDisease TypeMondoid

      Bibliography

      🔙[Back to Target (Human)]
      We use cookies to ensure the website functions properly and, where permitted, to improve your experience. You can manage your preferences at any time in Settings. Learn more in our Cookie Policy.

      Shall we send you a message when we have discounts available?

      Remind me later

      Thank you! Please check your email inbox to confirm.

      Oops! Notifications are disabled.

      Privacy Policy Terms of Use Cookie Policy Terms and Conditions of Sale Sales Policy
      Products are supplied to verified businesses, institutions, and qualified professionals for research and development use only. Not for use in humans, animals, diagnosis, or therapy.
      Copyright © 2023–present Aladdin Scientific Corp. All rights reserved.