🌎 Ship to: United States
Basculer la navigation
Cart
Rechercher
Expédition le jour même pour tous les articles en stock.
Recherche Avancée
Commande rapide SDS / CoA Structure En vrac et personnalisé
Menu
Compte
Paramètres
྾
224,000+ produits de recherche · Triple ISO certified · COA & SDS disponible pour chaque produit · Expédition le jour même sur les articles en stock

VAMP1

DescriptionVesicle-associated membrane protein 1

Gene and Protein Information

Gene ID6843
Uniprot Accession IDs P23763 A8MVP3 D3DUR3 O75468 Q15857 Q6FG94 Q8IVC9 VAMP-1
Ensembl ID ENSP00000379602
Symbole SYB1 SYB1 CMS25 SPAX1 VAMP-1
FamilyBelongs to the synaptobrevin family.
Sequence
MSAPAQPPAEGTEGTAPGGGPPGPPPNMTSNRRLQQTQAQVEEVVDIIRVNVDKVLERDQKLSELDDRADALQAGASQFESSAAKLKRKYWWKNCKMMIMLGAICAIIVVVIVIYFFT
Homologous gene and protein info.
SpeciesGene IDGene SymbolNomNuméro d'identification fiscale Other Gene IDSources
Mouse22317Vamp1vesicle-associated membrane protein 110090MGI:1313276Inparanoid, OMA, EggNOG
Rat25624Vamp1vesicle-associated membrane protein 110116RGD:3948Inparanoid, OMA
Dog486726VAMP1vesicle associated membrane protein 19615VGNC:54386Inparanoid, OMA, EggNOG
Horse100059722VAMP1vesicle associated membrane protein 19796VGNC:24875Inparanoid, OMA, EggNOG
Cow513621VAMP1vesicle associated membrane protein 19913VGNC:36756Inparanoid, OMA, EggNOG
PigVAMP1vesicle associated membrane protein 1 [Source:HGNC Symbol;Acc:HGNC:12642]9823OMA, EggNOG
Chicken418273VAMP1vesicle-associated membrane protein 1 (synaptobrevin 1)9031CGNC:50722Inparanoid, OMA
Anole lizard100565724vamp1vesicle associated membrane protein 128377Inparanoid, EggNOG
Xenopusvamp2vesicle associated membrane protein 2 [Source:Xenbase;Acc:XB-GENE-5788095]8364OMA, EggNOG

Associated Recombinant Proteins

NomSpecification and purityExpression systemProtein labelDisponibilitéVoir les détails

Associated Antibodies

NomSpecificationsSpecies reactivityApplicationDisponibilitéVoir les détails

Associated Approved Drugs

    Associated Active Ligands

      Associated Diseases

      NomDirect Associated TargetsDisease TypeMondoid

      Bibliography

      🔙[Back to Target (Human)]
      We use cookies to ensure the website functions properly and, where permitted, to improve your experience. You can manage your preferences at any time in Settings. Learn more in our Cookie Policy.

      Shall we send you a message when we have discounts available?

      Remind me later

      Thank you! Please check your email inbox to confirm.

      Oops! Notifications are disabled.

      Privacy Policy Terms of Use Cookie Policy Terms and Conditions of Sale Sales Policy
      Products are supplied to verified businesses, institutions, and qualified professionals for research and development use only. Not for use in humans, animals, diagnosis, or therapy.
      Copyright © 2023–present Aladdin Scientific Corp. All rights reserved.