🌎 Ship to: United States
Basculer la navigation
Cart
Rechercher
Expédition le jour même pour tous les articles en stock.
Recherche Avancée
Commande rapide SDS / CoA Structure En vrac et personnalisé
Menu
Compte
Paramètres
྾
224,000+ produits de recherche · Triple ISO certified · COA & SDS disponible pour chaque produit · Expédition le jour même sur les articles en stock

VHL

Descriptionvon Hippel-Lindau disease tumor suppressor

Gene and Protein Information

Gene ID7428
Uniprot Accession IDs P40337 B2RE45 Q13599 Q6PDA9
Ensembl ID ENSP00000256474
Symbole RCA1 VHL1 pVHL HRCA1
FamilyBelongs to the VHL family.
Sequence
MPRRAENWDEAEVGAEEAGVEEYGPEEDGGEESGAEESGPEESGPEELGAEEEMEAGRPRPVLRSVNSREPSQVIFCNRSPRVVLPVWLNFDGEPQPYPTLPPGTGRRIHSYRGHLWLFRDAGTHDGLLVNQTELFVPSLNVDGQPIFANITLPVYTLKERCLQVVRSLVKPENYRRLDIVRSLYEDLEDHPNVQKDLERLTQERIAHQRMGD
Homologous gene and protein info.
SpeciesGene IDGene SymbolNomNuméro d'identification fiscale Other Gene IDSources
Chimp749769VHLvon Hippel-Lindau tumor suppressor9598VGNC:48915Inparanoid, OMA
Mouse22346Vhlvon Hippel-Lindau tumor suppressor10090MGI:103223Inparanoid, OMA, EggNOG
Rat24874Vhlvon Hippel-Lindau tumor suppressor10116RGD:3960Inparanoid, OMA, EggNOG
Cow540957VHLvon Hippel-Lindau tumor suppressor, E3 ubiquitin protein ligase9913Inparanoid, OMA, EggNOG
Pig100739306VHLvon Hippel-Lindau tumor suppressor9823OMA, EggNOG
Chicken416117VHLvon Hippel-Lindau tumor suppressor9031CGNC:50168Inparanoid, OMA
Anole lizard100560920vhlvon Hippel-Lindau tumor suppressor28377OMA, EggNOG
Xenopus549121vhlvon Hippel-Lindau tumor suppressor8364XB-GENE-493997Inparanoid, OMA, EggNOG
Zebrafish791202vhlvon Hippel-Lindau tumor suppressor7955ZDB-GENE-070112-1042Inparanoid, OMA, EggNOG

Associated Recombinant Proteins

NomSpecification and purityExpression systemProtein labelDisponibilitéVoir les détails

Associated Antibodies

NomSpecificationsSpecies reactivityApplicationDisponibilitéVoir les détails

Associated Approved Drugs

    Associated Active Ligands

      Associated Diseases

      NomDirect Associated TargetsDisease TypeMondoid

      Bibliography

      🔙[Back to Target (Human)]
      We use cookies to ensure the website functions properly and, where permitted, to improve your experience. You can manage your preferences at any time in Settings. Learn more in our Cookie Policy.

      Shall we send you a message when we have discounts available?

      Remind me later

      Thank you! Please check your email inbox to confirm.

      Oops! Notifications are disabled.

      Privacy Policy Terms of Use Cookie Policy Terms and Conditions of Sale Sales Policy
      Products are supplied to verified businesses, institutions, and qualified professionals for research and development use only. Not for use in humans, animals, diagnosis, or therapy.
      Copyright © 2023–present Aladdin Scientific Corp. All rights reserved.