🌎 Ship to: United States
Basculer la navigation
Cart
Rechercher
Expédition le jour même pour tous les articles en stock.
Recherche Avancée
Commande rapide SDS / CoA Structure En vrac et personnalisé
Menu
Compte
Paramètres
྾
224,000+ produits de recherche · Triple ISO certified · COA & SDS disponible pour chaque produit · Expédition le jour même sur les articles en stock

IL6R

DescriptionInterleukin-6 receptor subunit alpha

Gene and Protein Information

Gene ID3570
Uniprot Accession IDs P08887 A8KAE8 B2R6V4 Q16202 Q53EQ7 Q5FWG2 Q5VZ23 IL-6 receptor subunit alpha
Ensembl ID ENSP00000357470
Symbole IL6Q gp80 CD126 IL6RA IL6RQ IL-6RA IL-6R-1
FamilyBelongs to the type I cytokine receptor family. Type 3 subfamily.
Sequence
MLAVGCALLAALLAAPGAALAPRRCPAQEVARGVLTSLPGDSVTLTCPGVEPEDNATVHWVLRKPAAGSHPSRWAGMGRRLLLRSVQLHDSGNYSCYRAGRPAGTVHLLVDVPPEEPQLSCFRKSPLSNVVCEWGPRSTPSLTTKAVLLVRKFQNSPAEDFQEPCQYSQESQKFSCQLAVPEGDSSFYIVSMCVASSVGSKFSKTQTFQGCGILQPDPPANITVTAVARNPRWLSVTWQDPHSWNSSFYRLRFELRYRAERSKTFTTWMVKDLQHHCVIHDAWSGLRHVVQLRAQEEFGQGEWSEWSPEAMGTPWTESRSPPAENEVSTPMQALTTNKDDDNILFRDSANATSLPVQDSSSVPLPTFLVAGGSLAFGTLLCIAIVLRFKKTWKLRALKEGKTSMHPPYSLGQLVPERPRPTPVLVPLISPPVSPSSLGSDNTSSHNRPDARDPRSPYDISNTDYFFPR
Afficher plus
Homologous gene and protein info.
SpeciesGene IDGene SymbolNomNuméro d'identification fiscale Other Gene IDSources
Chimp469506IL6Rinterleukin 6 receptor9598VGNC:1271OMA, EggNOG
Macaque716690IL6Rinterleukin 6 receptor9544Inparanoid, OMA, EggNOG
Mouse16194Il6rainterleukin 6 receptor, alpha10090MGI:105304Inparanoid, OMA, EggNOG
Rat24499Il6rinterleukin 6 receptor10116RGD:2902Inparanoid, OMA, EggNOG
Dog612271IL6Rinterleukin 6 receptor9615VGNC:41993Inparanoid, OMA, EggNOG
Horse102148787IL6Rinterleukin 6 receptor9796VGNC:19035Inparanoid, OMA, EggNOG
Cow507359IL6Rinterleukin 6 receptor9913VGNC:30167Inparanoid, OMA, EggNOG
Pig399522IL6Rinterleukin 6 receptor9823Inparanoid, EggNOG
Opossum100020561IL6Rinterleukin 6 receptor13616OMA, EggNOG

Protein Classes

PANTHER Classes
protein    /    signaling molecule    /    defense/immunity protein    /    Interleukin-6 receptor subunit alpha
protein    /    signaling molecule    /    cytokine    /    Interleukin-6 receptor subunit alpha
DTO Classes
protein    /    Signaling    /    Cytokine    /    Interleukin-6 receptor subunit alpha

Associated Recombinant Proteins

NomSpecification and purityExpression systemProtein labelDisponibilitéVoir les détails

Associated Antibodies

NomSpecificationsSpecies reactivityApplicationDisponibilitéVoir les détails

Associated Approved Drugs

    Associated Active Ligands

      Associated Diseases

      NomDirect Associated TargetsDisease TypeMondoid

      Bibliography

      🔙[Back to Target (Human)]
      We use cookies to ensure the website functions properly and, where permitted, to improve your experience. You can manage your preferences at any time in Settings. Learn more in our Cookie Policy.

      Shall we send you a message when we have discounts available?

      Remind me later

      Thank you! Please check your email inbox to confirm.

      Oops! Notifications are disabled.

      Privacy Policy Terms of Use Cookie Policy Terms and Conditions of Sale Sales Policy
      Products are supplied to verified businesses, institutions, and qualified professionals for research and development use only. Not for use in humans, animals, diagnosis, or therapy.
      Copyright © 2023–present Aladdin Scientific Corp. All rights reserved.