🌎 Ship to: United States
Basculer la navigation
Cart
Rechercher
Expédition le jour même pour tous les articles en stock.
Recherche Avancée
Commande rapide SDS / CoA Structure En vrac et personnalisé
Menu
Compte
Paramètres
྾
224,000+ produits de recherche · Triple ISO certified · COA & SDS disponible pour chaque produit · Expédition le jour même sur les articles en stock

EBI3

DescriptionInterleukin-27 subunit beta

Gene and Protein Information

Gene ID10148
Uniprot Accession IDs Q14213 A0N0N2 O75269 IL-27 subunit beta
Ensembl ID ENSP00000221847
Symbole IL27B IL27B IL35B IL-27B
FamilyBelongs to the type I cytokine receptor family. Type 3 subfamily.
Sequence
MTPQLLLALVLWASCPPCSGRKGPPAALTLPRVQCRASRYPIAVDCSWTLPPAPNSTSPVSFIATYRLGMAARGHSWPCLQQTPTSTSCTITDVQLFSMAPYVLNVTAVHPWGSSSSFVPFITEHIIKPDPPEGVRLSPLAERQLQVQWEPPGSWPFPEIFSLKYWIRYKRQGAARFHRVGPIEATSFILRAVRPRARYYVQVAAQDLTDYGELSDWSLPATATMSLGK
Homologous gene and protein info.
SpeciesGene IDGene SymbolNomNuméro d'identification fiscale Other Gene IDSources
Chimp737135EBI3Epstein-Barr virus induced 39598OMA, EggNOG
Mouse50498Ebi3Epstein-Barr virus induced gene 310090MGI:1354171Inparanoid, OMA, EggNOG
Rat680609Ebi3Epstein-Barr virus induced 310116RGD:1589467Inparanoid, OMA, EggNOG
Dog485043EBI3Epstein-Barr virus induced 39615Inparanoid, OMA, EggNOG
Horse100063061EBI3Epstein-Barr virus induced 39796Inparanoid, OMA, EggNOG
Cow514933EBI3Epstein-Barr virus induced 39913Inparanoid, OMA, EggNOG
Pig100522599EBI3Epstein-Barr virus induced 39823OMA, EggNOG
Opossum100022641EBI3Epstein-Barr virus induced 313616Inparanoid, OMA, EggNOG
Anole lizard100567370LOC100567370interleukin-27 subunit beta28377OMA, EggNOG
Xenopus100486938ebi3Epstein-Barr virus induced 38364XB-GENE-984416Inparanoid, OMA, EggNOG
Zebrafish100134974ebi3Epstein-Barr virus induced 37955ZDB-GENE-070912-615Inparanoid, OMA, EggNOG

Protein Classes

PANTHER Classes
protein    /    signaling molecule    /    defense/immunity protein    /    Interleukin-27 subunit beta
protein    /    signaling molecule    /    cytokine    /    Interleukin-27 subunit beta
DTO Classes
protein    /    Signaling    /    Cytokine    /    Interleukin-27 subunit beta

Associated Recombinant Proteins

NomSpecification and purityExpression systemProtein labelDisponibilitéVoir les détails

Associated Antibodies

NomSpecificationsSpecies reactivityApplicationDisponibilitéVoir les détails

Associated Approved Drugs

    Associated Active Ligands

      Associated Diseases

      NomDirect Associated TargetsDisease TypeMondoid

      Bibliography

      🔙[Back to Target (Human)]
      We use cookies to ensure the website functions properly and, where permitted, to improve your experience. You can manage your preferences at any time in Settings. Learn more in our Cookie Policy.

      Shall we send you a message when we have discounts available?

      Remind me later

      Thank you! Please check your email inbox to confirm.

      Oops! Notifications are disabled.

      Privacy Policy Terms of Use Cookie Policy Terms and Conditions of Sale Sales Policy
      Products are supplied to verified businesses, institutions, and qualified professionals for research and development use only. Not for use in humans, animals, diagnosis, or therapy.
      Copyright © 2023–present Aladdin Scientific Corp. All rights reserved.