FFAR2

DescriptionFree fatty acid receptor 2

Gene and Protein Information

Gene ID2867
Uniprot Accession IDs O15552 B0M0J9 Q4VAZ3 Q4VAZ5 Q4VBL5
Ensembl ID ENSP00000473159
Symbole FFA2 GPCR43 GPR43 FFA2R GPR43
FamilyBelongs to the G-protein coupled receptor 1 family.
Sequence
MLPDWKSSLILMAYIIIFLTGLPANLLALRAFVGRIRQPQPAPVHILLLSLTLADLLLLLLLPFKIIEAASNFRWYLPKVVCALTSFGFYSSIYCSTWLLAGISIERYLGVAFPVQYKLSRRPLYGVIAALVAWVMSFGHCTIVIIVQYLNTTEQVRSGNEITCYENFTDNQLDVVLPVRLELCLVLFFIPMAVTIFCYWRFVWIMLSQPLVGAQRRRRAVGLAVVTLLNFLVCFGPYNVSHLVGYHQRKSPWWRSIAVVFSSLNASLDPLLFYFSSSVVRRAFGRGLQVLRNQGSSLLGRRGKDTAEGTNEDRGVGQGEGMPSSDFTTE
Afficher plus
Homologous gene and protein info.
SpeciesGene IDGene SymbolNomNuméro d'identification fiscale Other Gene IDSources
Chimp455948FFAR2free fatty acid receptor 29598VGNC:11096OMA, EggNOG
Macaque709026FFAR2free fatty acid receptor 29544Inparanoid, OMA, EggNOG
Mouse233079Ffar2free fatty acid receptor 210090MGI:2441731Inparanoid, OMA, EggNOG
Rat292794Ffar2free fatty acid receptor 210116RGD:1359614Inparanoid, OMA, EggNOG
Dog484580FFAR2free fatty acid receptor 29615VGNC:40831Inparanoid, OMA, EggNOG
Horse100059449FFAR2free fatty acid receptor 29796VGNC:51028Inparanoid, OMA, EggNOG
Cow522431FFAR2free fatty acid receptor 29913OMA, EggNOG
Opossum100015816FFAR2free fatty acid receptor 213616Inparanoid, OMA, EggNOG
PlatypusFFAR2free fatty acid receptor 2 [Source:HGNC Symbol;Acc:HGNC:4501]9258OMA, EggNOG

Protein Classes

DTO Classes
protein    /    G-protein coupled receptor    /    Class A rhodopsin like    /    Free fatty acid receptor    /    Free fatty acid receptor 2

Associated Recombinant Proteins

NomSpecification and purityExpression systemProtein labelDisponibilitéVoir les détails

Associated Antibodies

NomSpecificationsSpecies reactivityApplicationDisponibilitéVoir les détails

Associated Approved Drugs

    Associated Active Ligands

      Associated Diseases

      NomDirect Associated TargetsDisease TypeMondoid

      Bibliography

      Shall we send you a message when we have discounts available?

      Remind me later

      Thank you! Please check your email inbox to confirm.

      Oops! Notifications are disabled.