🌎 Ship to: United States
Basculer la navigation
Cart
Rechercher
Expédition le jour même pour tous les articles en stock.
Recherche Avancée
Commande rapide SDS CoA Structure
Menu
Compte
Paramètres
྾
224,000+ produits de recherche · Triple ISO certified · COA & SDS disponible pour chaque produit · Expédition le jour même sur les articles en stock

FFAR4

DescriptionFree fatty acid receptor 4

Gene and Protein Information

Gene ID338557
Uniprot Accession IDs Q5NUL3 Q495H1 Q5VY25 Q5VY26 Q7Z605 Q86SM7
Ensembl ID ENSP00000360538
Symbole GPR120 GPR129 O3FAR1 PGR4 GT01 PGR4 BMIQ10 GPR120 GPR129 O3FAR1
FamilyBelongs to the G-protein coupled receptor 1 family.
Sequence
MSPECARAAGDAPLRSLEQANRTRFPFFSDVKGDHRLVLAAVETTVLVLIFAVSLLGNVCALVLVARRRRRGATACLVLNLFCADLLFISAIPLVLAVRWTEAWLLGPVACHLLFYVMTLSGSVTILTLAAVSLERMVCIVHLQRGVRGPGRRARAVLLALIWGYSAVAALPLCVFFRVVPQRLPGADQEISICTLIWPTIPGEISWDVSFVTLNFLVPGLVIVISYSKILQTSEHLLDARAVVTHSEITKASRKRLTVSLAYSESHQIRVSQQDFRLFRTLFLLMVSFFIMWSPIIITILLILIQNFKQDLVIWPSLFFWVVAFTFANSALNPILYNMTLCRNEWKKIFCCFWFPEKGAILTDTSVKRNDLSIISG
Afficher plus
Homologous gene and protein info.
SpeciesGene IDGene SymbolNomNuméro d'identification fiscale Other Gene IDSources
Chimp740365FFAR4free fatty acid receptor 49598VGNC:3856OMA, EggNOG
Macaque700014FFAR4free fatty acid receptor 49544OMA, EggNOG
Mouse107221Ffar4free fatty acid receptor 410090MGI:2147577Inparanoid, OMA, EggNOG
Rat294075Ffar4free fatty acid receptor 410116RGD:1308252Inparanoid, OMA, EggNOG
Dog477774FFAR4free fatty acid receptor 49615VGNC:40832OMA, EggNOG
Horse100071163FFAR4free fatty acid receptor 49796VGNC:18002OMA, EggNOG
Cow533266FFAR4free fatty acid receptor 49913VGNC:28962OMA, EggNOG
PigFFAR4cone cGMP-specific 3',5'-cyclic phosphodiesterase subunit alpha' [Source:RefSeq peptide;Acc:NP_001191695]9823OMA, EggNOG
Anole lizard100564065ffar4free fatty acid receptor 428377OMA, EggNOG
Xenopusffar4free fatty acid receptor 4 [Source:Xenbase;Acc:XB-GENE-954927]8364OMA, EggNOG

Protein Classes

PANTHER Classes
protein    /    receptor    /    G-protein coupled receptor    /    Free fatty acid receptor 4
DTO Classes
protein    /    G-protein coupled receptor    /    Class A rhodopsin like    /    Free fatty acid receptor    /    Free fatty acid receptor 4

Associated Recombinant Proteins

NomSpecification and purityExpression systemProtein labelDisponibilitéVoir les détails

Associated Antibodies

NomSpecificationsSpecies reactivityApplicationDisponibilitéVoir les détails

Associated Approved Drugs

    Associated Active Ligands

      Associated Diseases

      NomDirect Associated TargetsDisease TypeMondoid

      Bibliography

      🔙[Back to Target (Human)]
      We use cookies to ensure the website functions properly and, where permitted, to improve your experience. You can manage your preferences at any time in Settings. Learn more in our Cookie Policy.

      Shall we send you a message when we have discounts available?

      Remind me later

      Thank you! Please check your email inbox to confirm.

      Oops! Notifications are disabled.

      Privacy Policy Terms of Use Cookie Policy Terms and Conditions of Sale Sales Policy
      Products are supplied to verified businesses, institutions, and qualified professionals for research and development use only. Not for use in humans, animals, diagnosis, or therapy.
      Copyright © 2023–present Aladdin Scientific Corp. All rights reserved.