KCNK17

DescriptionPotassium channel subfamily K member 17

Gene and Protein Information

Gene ID89822
Uniprot Accession IDs Q96T54 E9PB46 Q5TCF4 Q8TAW4 Q9BXD1 Q9H592
Ensembl ID ENSP00000362328
Symbole TALK2 TASK4 TALK2 TASK4 TALK-2 TASK-4 K2p17.1
FamilyBelongs to the two pore domain potassium channel (TC 1.A.1.8) family.
Sequence
MYRPRARAAPEGRVRGCAVPSTVLLLLAYLAYLALGTGVFWTLEGRAAQDSSRSFQRDKWELLQNFTCLDRPALDSLIRDVVQAYKNGASLLSNTTSMGRWELVGSFFFSVSTITTIGYGNLSPNTMAARLFCIFFALVGIPLNLVVLNRLGHLMQQGVNHWASRLGGTWQDPDKARWLAGSGALLSGLLLFLLLPPLLFSHMEGWSYTEGFYFAFITLSTVGFGDYVIGMNPSQRYPLWYKNMVSLWILFGMAWLALIIKLILSQLETPGRVCSCCHHSSKEDFKSQSWRQGPDREPESHSPQQGCYPEGPMGIIQHLEPSAHAAGCGKDS
Afficher plus
Homologous gene and protein info.
SpeciesGene IDGene SymbolNomNuméro d'identification fiscale Other Gene IDSources
Chimp748287KCNK17potassium two pore domain channel subfamily K member 179598VGNC:7898OMA, EggNOG
Macaque719574KCNK17potassium two pore domain channel subfamily K member 179544OMA, EggNOG
Dog481781KCNK16potassium two pore domain channel subfamily K member 169615OMA, EggNOG
Horse100065439KCNK17potassium two pore domain channel subfamily K member 179796VGNC:19295Inparanoid, OMA, EggNOG
Cow282264KCNK17potassium two pore domain channel subfamily K member 179913VGNC:30470Inparanoid, OMA, EggNOG
Pig106507367KCNK17potassium two pore domain channel subfamily K member 179823OMA, EggNOG
Chicken421423KCNK17potassium two pore domain channel subfamily K member 179031CGNC:7653Inparanoid, OMA, EggNOG
Anole lizard100564501kcnk17potassium two pore domain channel subfamily K member 1728377Inparanoid, OMA

Protein Classes

DTO Classes
protein    /    Ion channel    /    Two pore domain potassium channel family    /    Potassium channel subfamily K member 17

Associated Recombinant Proteins

NomSpecification and purityExpression systemProtein labelDisponibilitéVoir les détails

Associated Antibodies

NomSpecificationsSpecies reactivityApplicationDisponibilitéVoir les détails

Associated Approved Drugs

    Associated Active Ligands

      Associated Diseases

      NomDirect Associated TargetsDisease TypeMondoid

      Bibliography

      Shall we send you a message when we have discounts available?

      Remind me later

      Thank you! Please check your email inbox to confirm.

      Oops! Notifications are disabled.