🌎 Livrer à: United States
Basculer la navigation
Panier
Rechercher
Expédition le jour même pour tous les articles en stock.
Recherche Avancée
Commande rapide SDS / CoA Structure En vrac et personnalisé
Menu
Compte
Paramètres
྾
340,000+ produits de recherche · Triple ISO certified · COA & SDS disponible pour chaque produit · Expédition le jour même sur les articles en stock

HAT1

DescriptionHistone acetyltransferase type B catalytic subunit

Gene and Protein Information

Gene ID8520
Uniprot Accession IDs O14929 Q49A44 Q53QF0 Q53SU4 Q6P594 Q8WWB9
Ensembl ID ENSP00000264108
Symbole KAT1 KAT1
FamilyBelongs to the HAT1 family.
Sequence
MAGFGAMEKFLVEYKSAVEKKLAEYKCNTNTAIELKLVRFPEDLENDIRTFFPEYTHQLFGDDETAFGYKGLKILLYYIAGSLSTMFRVEYASKVDENFDCVEADDVEGKIRQIIPPGFCTNTNDFLSLLEKEVDFKPFGTLLHTYSVLSPTGGENFTFQIYKADMTCRGFREYHERLQTFLMWFIETASFIDVDDERWHYFLVFEKYNKDGATLFATVGYMTVYNYYVYPDKTRPRVSQMLILTPFQGQGHGAQLLETVHRYYTEFPTVLDITAEDPSKSYVKLRDFVLVKLCQDLPCFSREKLMQGFNEDMAIEAQQKFKINKQHARRVYEILRLLVTDMSDAEQYRSYRLDIKRRLISPYKKKQRDLAKMRKCLRPEELTNQMNQIEISMQHEQLEESFQELVEDYRRVIERLAQE
Afficher plus
Homologous gene and protein info.
SpeciesGene IDGene SymbolNomNuméro d'identification fiscale Other Gene IDSources
Chimp459737HAT1histone acetyltransferase 19598VGNC:1956OMA, EggNOG
Macaque695933HAT1histone acetyltransferase 19544Inparanoid, OMA, EggNOG
Mouse107435Hat1histone aminotransferase 110090MGI:96013Inparanoid, OMA, EggNOG
Rat296501Hat1histone acetyltransferase 110116RGD:1305716Inparanoid, OMA, EggNOG
Dog478799HAT1histone acetyltransferase 19615VGNC:50624Inparanoid, OMA, EggNOG
Horse100063802HAT1histone acetyltransferase 19796VGNC:50591Inparanoid, OMA, EggNOG
Cow509329HAT1histone acetyltransferase 19913VGNC:49063Inparanoid, OMA, EggNOG
Pig100622317HAT1histone acetyltransferase 19823OMA, EggNOG
Opossum100025069HAT1histone acetyltransferase 113616Inparanoid, OMA, EggNOG
PlatypusHAT1histone acetyltransferase 1 [Source:HGNC Symbol;Acc:HGNC:4821]9258OMA, EggNOG
Chicken374037HAT1histone acetyltransferase 19031CGNC:7250Inparanoid, OMA, EggNOG
Anole lizard100554251hat1histone acetyltransferase 128377Inparanoid, OMA, EggNOG
Xenopus100145138hat1histone acetyltransferase 18364XB-GENE-952148Inparanoid, OMA, EggNOG
Zebrafish447833hat1histone acetyltransferase 17955ZDB-GENE-040912-99Inparanoid, OMA, EggNOG
C. elegans176458hat-1Histone AcetylTransferase6239Inparanoid, OMA
S.cerevisiae856106HAT1histone acetyltransferase catalytic subunit HAT14932S000005922Inparanoid, OMA, EggNOG

Protein Classes

PANTHER Classes
protein    /    transferase    /    acetyltransferase    /    Histone acetyltransferase type B catalytic subunit
DTO Classes
protein    /    Enzyme    /    Transferase    /    Acetyltransferase    /    Histone acetyltransferase type B catalytic subunit

Associated Recombinant Proteins

NomSpecification and purityExpression systemProtein labelDisponibilitéVoir les détails

Associated Antibodies

NomSpécificationsSpecies reactivityApplicationDisponibilitéVoir les détails

Associated Approved Drugs

    Associated Active Ligands

      Associated Diseases

      NomDirect Associated TargetsDisease TypeMondoid

      Bibliography

      🔙[Back to Target (Human)]
      Nous utilisons des cookies pour garantir le bon fonctionnement du site et, lorsque cela est autorisé, pour améliorer votre expérience. Vous pouvez gérer vos préférences à tout moment dans les Paramètres. Pour en savoir plus, consultez notre Politique relative aux cookies.

      Souhaitez-vous que nous vous envoyions un message lorsque des réductions seront disponibles?

      Me rappeler plus tard

      Merci ! Veuillez vérifier votre boîte de réception e-mail pour confirmer.

      Oups ! Les notifications sont désactivées.

      Privacy Policy Terms of Use Cookie Policy Terms and Conditions of Sale Sales Policy
      Products are supplied to verified businesses, institutions, and qualified professionals for research and development use only. Not for use in humans, animals, diagnosis, or therapy.
      Copyright © 2023–present Aladdin Scientific Corporation. All rights reserved.