🌎 Ship to: United States
Basculer la navigation
Cart
Rechercher
Expédition le jour même pour tous les articles en stock.
Recherche Avancée
Commande rapide SDS / CoA Structure En vrac et personnalisé
Menu
Compte
Paramètres
྾
224,000+ produits de recherche · Triple ISO certified · COA & SDS disponible pour chaque produit · Expédition le jour même sur les articles en stock

HMGB1

DescriptionHigh mobility group protein B1

Gene and Protein Information

Gene ID3146
Uniprot Accession IDs P09429 A5D8W9 Q14321 Q5T7C3 Q6IBE1
Ensembl ID ENSP00000345347
Symbole HMG1 HMG1 HMG3 HMG-1 SBP-1
FamilyBelongs to the HMGB family.
Sequence
MGKGDPKKPRGKMSSYAFFVQTCREEHKKKHPDASVNFSEFSKKCSERWKTMSAKEKGKFEDMAKADKARYEREMKTYIPPKGETKKKFKDPNAPKRPPSAFFLFCSEYRPKIKGEHPGLSIGDVAKKLGEMWNNTAADDKQPYEKKAAKLKEKYEKDIAAYRAKGKPDAAKKGVVKAEKSKKKKEEEEDEEDEEDEEEEEDEEDEDEEEDDDDE
Homologous gene and protein info.
SpeciesGene IDGene SymbolNomNuméro d'identification fiscale Other Gene IDSources
Mouse15289Hmgb1high mobility group box 110090MGI:96113Inparanoid, OMA, EggNOG
Rat108349189LOC108349189high mobility group protein B1 pseudogene10116RGD:11468204OMA, EggNOG
Dog403170HMGB1high mobility group box 19615Inparanoid, OMA, EggNOG
Horse100033873HMGB1high mobility group box 19796Inparanoid, OMA
Cow282691HMGB1high mobility group box 19913VGNC:53816Inparanoid, OMA
Pig445521HMGB1high mobility group box 19823Inparanoid, OMA, EggNOG
Opossum100020248HMGB1high mobility group box 113616OMA, EggNOG
Anole lizard100560708hmgb1high mobility group box 128377OMA, EggNOG
Xenopus394834hmgb1high mobility group box 18364XB-GENE-1001206OMA, EggNOG

Protein Classes

PANTHER Classes
protein    /    nucleic acid binding    /    chromatin/chromatin-binding protein    /    High mobility group protein B1
protein    /    nucleic acid binding    /    signaling molecule    /    High mobility group protein B1
protein    /    nucleic acid binding    /    HMG box transcription factor    /    High mobility group protein B1
DTO Classes
protein    /    Nucleic acid binding    /    DNA binding protein    /    Chromatin/chromatin-binding protein    /    High mobility group protein B1

Associated Recombinant Proteins

NomSpecification and purityExpression systemProtein labelDisponibilitéVoir les détails

Associated Antibodies

NomSpecificationsSpecies reactivityApplicationDisponibilitéVoir les détails

Associated Approved Drugs

    Associated Active Ligands

      Associated Diseases

      NomDirect Associated TargetsDisease TypeMondoid

      Bibliography

      🔙[Back to Target (Human)]
      Nous utilisons des cookies pour garantir le bon fonctionnement du site et, lorsque cela est autorisé, pour améliorer votre expérience. Vous pouvez gérer vos préférences à tout moment dans les Paramètres. Pour en savoir plus, consultez notre Politique relative aux cookies.

      Shall we send you a message when we have discounts available?

      Remind me later

      Thank you! Please check your email inbox to confirm.

      Oops! Notifications are disabled.

      Privacy Policy Terms of Use Cookie Policy Terms and Conditions of Sale Sales Policy
      Products are supplied to verified businesses, institutions, and qualified professionals for research and development use only. Not for use in humans, animals, diagnosis, or therapy.
      Copyright © 2023–present Aladdin Scientific Corp. All rights reserved.