Basculer la navigation 
Rechercher
340,000+ produits de recherche · Triple ISO certified · COA & SDS disponible pour chaque produit · Expédition le jour même sur les articles en stock
| Description | N-arachidonyl glycine receptor |
|---|
Gene and Protein Information
| Gene ID | 2841 |
|---|---|
| Uniprot Accession IDs | Q14330 Q6GTM3 Q96HI6 Q9H2L2 NAGly receptor |
| Ensembl ID | ENSP00000343428 |
| Symbole | GPCRW |
| Family | Belongs to the G-protein coupled receptor 1 family. |
| Sequence | MITLNNQDQPVPFNSSHPDEYKIAALVFYSCIFIIGLFVNITALWVFSCTTKKRTTVTIYMMNVALVDLIFIMTLPFRMFYYAKDEWPFGEYFCQILGALTVFYPSIALWLLAFISADRYMAIVQPKYAKELKNTCKAVLACVGVWIMTLTTTTPLLLLYKDPDKDSTPATCLKISDIIYLKAVNVLNLTRLTFFFLIPLFIMIGCYLVIIHNLLHGRTSKLKPKVKEKSIRIIITLLVQVLVCFMPFHICFAFLMLGTGENSYNPWGAFTTFLMNLSTCLDVILYYIVSKQFQARVISVMLYRNYLRSMRRKSFRSGSLRSLSNINSEML Afficher plus |
Homologous gene and protein info.
| Species | Gene ID | Gene Symbol | Nom | Numéro d'identification fiscale | Other Gene ID | Sources |
|---|---|---|---|---|---|---|
| Chimp | 738311 | GPR18 | G protein-coupled receptor 18 | 9598 | VGNC:5065 | OMA, EggNOG |
| Macaque | 698714 | GPR18 | G protein-coupled receptor 18 | 9544 | Inparanoid, OMA | |
| Mouse | 110168 | Gpr18 | G protein-coupled receptor 18 | 10090 | MGI:107859 | Inparanoid, OMA, EggNOG |
| Rat | 679957 | Gpr18 | G protein-coupled receptor 18 | 10116 | RGD:1304889 | Inparanoid, OMA, EggNOG |
| Dog | 485531 | GPR18 | G protein-coupled receptor 18 | 9615 | VGNC:41420 | Inparanoid, OMA, EggNOG |
| Horse | 100147633 | GPR18 | G protein-coupled receptor 18 | 9796 | VGNC:18531 | Inparanoid, OMA, EggNOG |
| Cow | 540038 | GPR18 | G protein-coupled receptor 18 | 9913 | VGNC:29574 | Inparanoid, OMA, EggNOG |
| Chicken | 100858263 | GPR18 | G protein-coupled receptor 18 | 9031 | CGNC:66127 | OMA, EggNOG |
| Anole lizard | 103278302 | gpr18 | G protein-coupled receptor 18 | 28377 | Inparanoid, OMA, EggNOG | |
| Xenopus | GPR18 | G protein-coupled receptor 18 [Source:HGNC Symbol;Acc:HGNC:4472] | 8364 | OMA, EggNOG | ||
| Zebrafish | 556711 | gpr18 | G protein-coupled receptor 18 | 7955 | ZDB-GENE-070912-159 | Inparanoid, OMA, EggNOG |
Protein Classes
DTO Classes
protein / G-protein coupled receptor / Class A rhodopsin like / N-arachidonyl glycine receptor
protein / G-protein coupled receptor / Class A rhodopsin like / N-arachidonyl glycine receptor
Associated Recombinant Proteins
| Nom | Specification and purity | Expression system | Protein label | Disponibilité | Voir les détails |
|---|
Associated Antibodies
| Nom | Spécifications | Species reactivity | Application | Disponibilité | Voir les détails |
|---|
Associated Approved Drugs
Associated Active Ligands
Associated Diseases
| Nom | Direct Associated Targets | Disease Type | Mondoid |
|---|
Bibliography
Me rappeler plus tard
Products are supplied to verified businesses, institutions, and qualified professionals for research and development use only. Not for use in humans, animals, diagnosis, or therapy.
Copyright © 2023–present Aladdin Scientific Corporation. All rights reserved.