Basculer la navigation 
Rechercher
340,000+ produits de recherche · Triple ISO certified · COA & SDS disponible pour chaque produit · Expédition le jour même sur les articles en stock
| Description | KiSS-1 receptor |
|---|
Gene and Protein Information
| Gene ID | 84634 |
|---|---|
| Uniprot Accession IDs | Q969F8 A5D8U2 B2RTV1 Q96QG0 KiSS-1R |
| Ensembl ID | ENSP00000234371 |
| Symbole | AXOR12 GPR54 HH8 CPPB1 GPR54 AXOR12 KISS-1R HOT7T175 |
| Family | Belongs to the G-protein coupled receptor 1 family. |
| Sequence | MHTVATSGPNASWGAPANASGCPGCGANASDGPVPSPRAVDAWLVPLFFAALMLLGLVGNSLVIYVICRHKPMRTVTNFYIANLAATDVTFLLCCVPFTALLYPLPGWVLGDFMCKFVNYIQQVSVQATCATLTAMSVDRWYVTVFPLRALHRRTPRLALAVSLSIWVGSAAVSAPVLALHRLSPGPRAYCSEAFPSRALERAFALYNLLALYLLPLLATCACYAAMLRHLGRVAVRPAPADSALQGQVLAERAGAVRAKVSRLVAAVVLLFAACWGPIQLFLVLQALGPAGSWHPRSYAAYALKTWAHCMSYSNSALNPLLYAFLGSHFRQAFRRVCPCAPRRPRRPRRPGPSDPAAPHAELLRLGSHPAPARAQKPGSSGLAARGLCVLGEDNAPL Afficher plus |
Homologous gene and protein info.
| Species | Gene ID | Gene Symbol | Nom | Numéro d'identification fiscale | Other Gene ID | Sources |
|---|---|---|---|---|---|---|
| Chimp | 741289 | KISS1R | KISS1 receptor | 9598 | VGNC:2333 | OMA, EggNOG |
| Macaque | 574305 | KISS1R | KISS1 receptor | 9544 | OMA, EggNOG | |
| Mouse | 114229 | Kiss1r | KISS1 receptor | 10090 | MGI:2148793 | Inparanoid, OMA, EggNOG |
| Rat | 78976 | Kiss1r | KISS1 receptor | 10116 | RGD:70930 | Inparanoid, OMA, EggNOG |
| Dog | 612374 | KISS1R | KISS1 receptor | 9615 | VGNC:42421 | Inparanoid, OMA, EggNOG |
| Cow | 528699 | KISS1R | KISS1 receptor | 9913 | VGNC:30617 | OMA, EggNOG |
| Pig | 733704 | KISS1R | KISS1 receptor | 9823 | OMA, EggNOG | |
| Platypus | KISS1R | KISS1 receptor [Source:HGNC Symbol;Acc:HGNC:4510] | 9258 | OMA, EggNOG | ||
| Anole lizard | 100567120 | LOC100567120 | G-protein coupled receptor 54 | 28377 | OMA, EggNOG | |
| Xenopus | 100316929 | kiss1r | KISS1 receptor | 8364 | XB-GENE-990075 | OMA, EggNOG |
| Zebrafish | 100002715 | kiss1rb | KISS1 receptor b | 7955 | ZDB-GENE-060526-54 | Inparanoid, OMA |
Protein Classes
DTO Classes
protein / G-protein coupled receptor / Class A rhodopsin like / Kisspeptin receptor / Kiss-1 receptor
protein / G-protein coupled receptor / Class A rhodopsin like / Kisspeptin receptor / Kiss-1 receptor
Associated Recombinant Proteins
| Nom | Specification and purity | Expression system | Protein label | Disponibilité | Voir les détails |
|---|
Associated Antibodies
| Nom | Specifications | Species reactivity | Application | Disponibilité | Voir les détails |
|---|
Associated Approved Drugs
Associated Active Ligands
Associated Diseases
| Nom | Direct Associated Targets | Disease Type | Mondoid |
|---|
Bibliography
Me rappeler plus tard
Products are supplied to verified businesses, institutions, and qualified professionals for research and development use only. Not for use in humans, animals, diagnosis, or therapy.
Copyright © 2023–present Aladdin Scientific Corporation. All rights reserved.