🌎 Ship to: United States
Basculer la navigation
Cart
Rechercher
Expédition le jour même pour tous les articles en stock.
Recherche Avancée
Commande rapide SDS / CoA Structure En vrac et personnalisé
Menu
Compte
Paramètres
྾
224,000+ produits de recherche · Triple ISO certified · COA & SDS disponible pour chaque produit · Expédition le jour même sur les articles en stock

FLOT2

DescriptionFlotillin-2

Gene and Protein Information

Gene ID2319
Uniprot Accession IDs Q14254
Ensembl ID ENSP00000378368
Symbole ESA1 M17S1 ESA ECS1 ESA1 ECS-1 M17S1
FamilyBelongs to the band 7/mec-2 family. Flotillin subfamily.
Sequence
MGNCHTVGPNEALVVSGGCCGSDYKQYVFGGWAWAWWCISDTQRISLEIMTLQPRCEDVETAEGVALTVTGVAQVKIMTEKELLAVACEQFLGKNVQDIKNVVLQTLEGHLRSILGTLTVEQIYQDRDQFAKLVREVAAPDVGRMGIEILSFTIKDVYDKVDYLSSLGKTQTAVVQRDADIGVAEAERDAGIREAECKKEMLDVKFMADTKIADSKRAFELQKSAFSEEVNIKTAEAQLAYELQGAREQQKIRQEEIEIEVVQRKKQIAVEAQEILRTDKELIATVRRPAEAEAHRIQQIAEGEKVKQVLLAQAEAEKIRKIGEAEAAVIEAMGKAEAERMKLKAEAYQKYGDAAKMALVLEALPQIAAKIAAPLTKVDEIVVLSGDNSKVTSEVNRLLAELPASVHALTGVDLSKIPLIKKATGVQV
Afficher plus
Homologous gene and protein info.
SpeciesGene IDGene SymbolNomNuméro d'identification fiscale Other Gene IDSources
Chimp454537FLOT2flotillin 29598VGNC:9433OMA, EggNOG
Macaque716527FLOT2flotillin 29544Inparanoid, OMA, EggNOG
Mouse14252Flot2flotillin 210090MGI:103309Inparanoid, OMA, EggNOG
Rat83764Flot2flotillin 210116RGD:70993Inparanoid, OMA
Horse100072090FLOT2flotillin 29796VGNC:18064Inparanoid, OMA, EggNOG
Cow615679FLOT2flotillin 29913VGNC:29037Inparanoid, OMA, EggNOG
Pig100518752FLOT2flotillin 29823OMA, EggNOG
Opossum100025079FLOT2flotillin 213616Inparanoid, OMA, EggNOG
Anole lizard100563055flot2flotillin 228377Inparanoid, OMA, EggNOG
Xenopus496443flot2flotillin 28364XB-GENE-5910825Inparanoid, OMA, EggNOG
Zebrafish245698flot2aflotillin 2a7955ZDB-GENE-020430-3Inparanoid, OMA
Zebrafish393612flot2bflotillin 2b7955ZDB-GENE-040426-1368OMA, EggNOG

Associated Recombinant Proteins

NomSpecification and purityExpression systemProtein labelDisponibilitéVoir les détails

Associated Antibodies

NomSpecificationsSpecies reactivityApplicationDisponibilitéVoir les détails

Associated Approved Drugs

    Associated Active Ligands

      Associated Diseases

      NomDirect Associated TargetsDisease TypeMondoid

      Bibliography

      🔙[Back to Target (Human)]
      We use cookies to ensure the website functions properly and, where permitted, to improve your experience. You can manage your preferences at any time in Settings. Learn more in our Cookie Policy.

      Shall we send you a message when we have discounts available?

      Remind me later

      Thank you! Please check your email inbox to confirm.

      Oops! Notifications are disabled.

      Privacy Policy Terms of Use Cookie Policy Terms and Conditions of Sale Sales Policy
      Products are supplied to verified businesses, institutions, and qualified professionals for research and development use only. Not for use in humans, animals, diagnosis, or therapy.
      Copyright © 2023–present Aladdin Scientific Corp. All rights reserved.